(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE319

ALDEN1_2.PE319       Location/Qualifiers
FT   CDS_pept        357985..358341
FT                   /locus_tag="Alide_0327"
FT                   /gene_family="HOG000219899" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04663"
FT                   /codon_start="1"
FT                   /product="phenol hydroxylase conserved region protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Phenol hydroxylase conserved region; KEGG:
FT                   rpf:Rpic12D_3551 phenol hydroxylase conserved region"
FT                   /db_xref="GI:319761057"
FT                   /db_xref="InterPro:IPR006756"
FT                   /db_xref="GeneID:10102350"
FT                   /translation="MAVTSAAPYDFPQQDTADKFPAPLLYIGWEDHKMFCAPFCVPMPP
FT                   ATRFGDMVQGALPGLYGAHPDFARIDWNRAEWFVSGKPFTPDMDKTVAENGLGHKSVIR
FT                   FRTPGLTGLQGSCF"
FT                   /protein_id="YP_004124994.1"
     ATGGCCGTCA CATCCGCCGC CCCCTACGAC TTCCCGCAGC AGGACACCGC CGACAAGTTC        60
     CCCGCGCCGC TGCTGTACAT CGGCTGGGAA GACCACAAGA TGTTCTGCGC GCCGTTCTGC       120
     GTGCCCATGC CGCCCGCTAC CCGGTTCGGC GACATGGTGC AGGGCGCGCT GCCCGGCCTC       180
     TACGGCGCGC ACCCCGACTT CGCGCGCATC GACTGGAACC GGGCCGAATG GTTCGTCTCG       240
     GGCAAGCCCT TCACCCCCGA CATGGACAAG ACCGTGGCCG AGAACGGCCT GGGCCACAAG       300
     AGCGTGATCC GCTTCCGCAC GCCCGGGCTG ACCGGCCTGC AGGGTTCGTG CTTTTGA          357
//

If you have problems or comments...

PBIL Back to PBIL home page