(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE32

ALDEN1_2.PE32        Location/Qualifiers
FT   CDS_pept        39923..41176
FT                   /locus_tag="Alide_0032"
FT                   /gene_family="HOG000290821" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /codon_start="1"
FT                   /product="nucleoside recognition domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   ajs:Ajs_0012 nucleoside recognition domain-containing
FT                   protein"
FT                   /db_xref="GI:319760770"
FT                   /db_xref="GO:0001882"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="GeneID:10102055"
FT                   /translation="MALNRVWTAFFLIAFATAAVRWLLGEAGIFQALLSAMFDGARAGF
FT                   EISLGLAGIMALWLGLMRVGEQAGMVELLARLAGPLLRRLFPGVPAGHPAQGAMTLNIS
FT                   ANLLGLDNAATPLGLKAMQELQTLNREPEGQASNAQIMFVVMNTAGLTLIPTSVIAIRQ
FT                   SVALKQGLGAGFNAADIFLPTLLVTFASLLAGVLSVAVAQRLPLWRARLLLPLLAVGSL
FT                   LAAAVAALSRLPAERAAQVAGTTGAAVILGVVALFLLAGAWRRVNIYDAFIDGAKEGFG
FT                   VAVQIIPYLIAILVAIGVFRAAGCMDALLAALGAGVAALGWNTDFLPALPVGLMKVLSG
FT                   AGARGLMIDVLQTHGVDSFVGRLAAIIQGSTETTFYVLAVYFGSVGVKHTRHALACALL
FT                   ADAVGLIAAIGVGYAMLR"
FT                   /protein_id="YP_004124707.1"
     ATGGCGCTCA ACCGGGTCTG GACCGCCTTC TTCCTGATCG CCTTCGCCAC CGCCGCCGTG        60
     CGCTGGCTGC TGGGCGAGGC GGGCATTTTC CAGGCCCTGC TGTCGGCGAT GTTCGACGGC       120
     GCGCGCGCGG GCTTCGAGAT CTCGCTGGGC CTGGCCGGCA TCATGGCGCT GTGGCTGGGC       180
     CTGATGCGCG TGGGCGAGCA GGCCGGCATG GTGGAGCTGC TGGCGCGCCT GGCCGGGCCG       240
     CTCTTGCGGC GGCTGTTTCC CGGCGTGCCC GCGGGCCACC CGGCCCAGGG CGCGATGACG       300
     CTAAACATAT CGGCCAACCT GCTGGGGCTG GACAACGCCG CCACGCCGCT GGGCCTGAAG       360
     GCCATGCAGG AGCTGCAGAC CCTGAACCGC GAGCCCGAAG GCCAGGCCAG CAACGCGCAG       420
     ATCATGTTCG TGGTCATGAA CACGGCTGGG CTCACGCTGA TACCGACCTC GGTCATCGCC       480
     ATACGCCAGA GCGTGGCGCT CAAGCAGGGG TTGGGCGCGG GCTTCAACGC GGCGGATATC       540
     TTCCTGCCCA CGCTGCTGGT CACCTTCGCC TCGCTGCTTG CAGGCGTGCT GTCCGTGGCC       600
     GTGGCGCAGC GCCTGCCGCT GTGGCGCGCG CGACTGCTGC TGCCGCTGCT GGCCGTGGGC       660
     AGCCTGCTGG CGGCGGCCGT GGCGGCCCTC TCGCGCCTGC CTGCCGAGCG CGCGGCCCAG       720
     GTGGCGGGCA CCACGGGCGC GGCCGTCATC CTGGGCGTGG TGGCGCTCTT CCTGCTGGCC       780
     GGCGCCTGGC GCCGCGTGAA CATATACGAC GCGTTCATCG ACGGCGCCAA GGAGGGCTTT       840
     GGCGTTGCCG TGCAGATCAT TCCCTACCTG ATCGCCATTC TGGTAGCCAT CGGCGTGTTC       900
     CGCGCCGCCG GCTGCATGGA CGCGCTACTG GCCGCCCTGG GCGCGGGCGT GGCGGCGCTG       960
     GGCTGGAACA CCGACTTCCT GCCCGCCCTG CCCGTGGGGC TGATGAAGGT GCTCTCGGGC      1020
     GCGGGCGCGC GCGGCCTGAT GATCGACGTG CTGCAGACGC ACGGCGTGGA CTCCTTCGTG      1080
     GGGCGCCTGG CCGCCATCAT CCAGGGCTCC ACCGAGACCA CCTTCTACGT GCTGGCCGTG      1140
     TACTTCGGCA GCGTGGGCGT GAAGCACACG CGCCACGCGC TCGCCTGCGC GCTGCTGGCC      1200
     GACGCCGTGG GGCTCATCGC CGCCATCGGC GTGGGCTACG CCATGCTGCG CTGA            1254
//

If you have problems or comments...

PBIL Back to PBIL home page