(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE320

ALDEN1_2.PE320       Location/Qualifiers
FT   CDS_pept        358412..359482
FT                   /locus_tag="Alide_0328"
FT                   /gene_family="HOG000263662" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00970"
FT                   /codon_start="1"
FT                   /product="oxidoreductase fad-binding domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Oxidoreductase FAD-binding domain protein;
FT                   ferredoxin; oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; KEGG: azo:azo1850 phenol 2-monooxygenase"
FT                   /db_xref="GI:319761058"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001221"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="GeneID:10102351"
FT                   /translation="MSHQLTIEPLGQVIEVEEGQTILDAALRAGIYLPHACCHGLCGTC
FT                   KVQVTDGEVEHGEASGFALMDYERDEGLCLACCATLESDSAVIEAEIDDEPDALNLPVQ
FT                   DFAGVVSRIEDLTPTIKGVWIELDAPMTFQAGQYINLQIPGESQPRAFSIASSPAQASE
FT                   IELNIRLVPGGKGTGWVHQQLRPGERVRLSGPYGRFFVRASAHDKQGLGYLFLAGGSGL
FT                   SSPRSMVLDLLAAGGDKPITLVNGARAQDELYHHAEFLQLAAEHPRFTYVAALSGEPEG
FT                   SGWQGARGYVHEAAKAHFGNDFRGHKAYLCGPPLMIDACISTLMQGRLFERDIYTEKFI
FT                   SAADAQQVRSPLFKKI"
FT                   /protein_id="YP_004124995.1"
     ATGAGCCACC AGCTCACCAT TGAACCGCTC GGCCAGGTGA TCGAGGTCGA GGAAGGCCAG        60
     ACCATCCTCG ACGCCGCCCT GCGCGCCGGC ATCTACCTGC CCCACGCCTG CTGCCACGGG       120
     CTGTGCGGCA CCTGCAAGGT CCAGGTCACC GACGGCGAAG TCGAACACGG CGAGGCCAGC       180
     GGCTTCGCGC TCATGGACTA CGAGCGCGAC GAGGGCCTGT GCCTGGCCTG CTGCGCCACG       240
     CTGGAGTCCG ACAGCGCCGT GATCGAGGCC GAGATCGACG ACGAGCCCGA CGCGCTGAAC       300
     CTGCCGGTGC AGGACTTCGC CGGCGTGGTC TCGCGCATCG AGGACCTCAC GCCCACCATC       360
     AAGGGCGTGT GGATCGAGCT GGACGCGCCC ATGACCTTCC AGGCCGGGCA GTACATCAAC       420
     CTGCAGATCC CGGGCGAAAG CCAGCCGCGC GCCTTCTCCA TCGCCAGCAG CCCGGCGCAG       480
     GCCAGCGAGA TCGAGCTCAA CATCCGCCTG GTGCCCGGCG GCAAGGGCAC GGGCTGGGTG       540
     CACCAGCAGC TGCGCCCGGG CGAGCGCGTG CGCCTGTCCG GCCCCTACGG GCGCTTTTTC       600
     GTGCGCGCCT CGGCGCACGA CAAGCAAGGG CTGGGCTACC TGTTCCTGGC CGGCGGCTCC       660
     GGCCTGTCCA GCCCGCGCTC CATGGTGCTG GACCTGCTCG CCGCCGGCGG CGACAAGCCC       720
     ATCACCCTGG TCAACGGCGC GCGCGCGCAG GACGAGCTGT ACCACCACGC GGAATTCCTG       780
     CAGCTGGCCG CCGAGCACCC GCGCTTCACC TACGTGGCGG CGCTCTCGGG CGAGCCCGAG       840
     GGCAGCGGCT GGCAGGGCGC GCGCGGCTAC GTGCACGAGG CCGCCAAGGC GCACTTCGGC       900
     AACGACTTCC GCGGCCACAA GGCCTACCTG TGCGGCCCGC CGCTGATGAT CGACGCCTGC       960
     ATCAGCACGC TGATGCAGGG CCGCCTGTTC GAGCGCGACA TCTACACCGA GAAGTTCATC      1020
     TCGGCCGCCG ACGCGCAGCA GGTGCGCAGC CCGCTGTTCA AGAAGATCTG A               1071
//

If you have problems or comments...

PBIL Back to PBIL home page