(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE322

ALDEN1_2.PE322       Location/Qualifiers
FT   CDS_pept        359860..360786
FT                   /locus_tag="Alide_0330"
FT                   /gene_family="HOG000219891" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03211"
FT                   /codon_start="1"
FT                   /product="catechol 2,3 dioxygenase"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0218 catechol 2,3-dioxygenase;
FT                   TIGRFAM: catechol 2,3 dioxygenase; PFAM:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="GI:319761060"
FT                   /db_xref="GO:0008198"
FT                   /db_xref="GO:0018577"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR017624"
FT                   /db_xref="GeneID:10102353"
FT                   /translation="MAMTGVLRPGHAQLRVLDLEESVQWYTDVMGLVPMGRDQQGRAYF
FT                   KTRAERDHNSVVLRQADQAGIDFFAFKVLDKATLEDFDRKLQAYGVKTERIPAGELLET
FT                   GERVRFKIPTGHTIELYAEKTDVGNGIGYQDPDVDVLDGPGIRPIRMDHCLLYGGDIDG
FT                   NVKLFTEVLGFTLVERVKLEDGKTDLAVWLTCSAKAHDIAMVRHGEDGKLHHVSFQMPS
FT                   WESVLRAADIMSVNRVSIDIGPTRHGITQGTTIYFFDPSGNRLETFCGGYDHYPDMHPI
FT                   TWSWEHVGRGIFYHDRKLNDAFLSVVT"
FT                   /protein_id="YP_004124997.1"
     ATGGCAATGA CAGGCGTTTT GCGCCCCGGA CACGCACAGC TGCGCGTGCT GGACCTGGAG        60
     GAATCGGTGC AGTGGTACAC CGACGTCATG GGCCTCGTGC CCATGGGCCG CGACCAGCAG       120
     GGCCGCGCGT ACTTCAAGAC CCGCGCCGAG CGCGACCACA ACAGCGTCGT GCTGCGCCAG       180
     GCCGACCAGG CCGGCATCGA CTTCTTCGCC TTCAAGGTGC TCGACAAGGC CACGCTGGAG       240
     GACTTCGACC GCAAGCTGCA GGCCTATGGT GTGAAGACCG AGCGCATCCC TGCCGGCGAA       300
     CTGCTGGAGA CCGGCGAGCG CGTGCGCTTC AAGATCCCCA CCGGCCACAC CATCGAGCTG       360
     TATGCCGAGA AGACCGACGT GGGCAACGGC ATCGGCTATC AGGACCCCGA CGTGGACGTG       420
     CTCGACGGCC CCGGCATCCG CCCGATCCGC ATGGACCACT GCCTGCTCTA CGGCGGCGAC       480
     ATCGACGGCA ACGTGAAGCT GTTCACCGAG GTGCTGGGCT TCACCCTGGT GGAGCGCGTG       540
     AAGCTCGAGG ACGGCAAGAC CGACCTGGCC GTGTGGCTCA CCTGCAGCGC CAAGGCGCAC       600
     GACATCGCCA TGGTGCGCCA CGGCGAGGAC GGCAAGCTGC ACCACGTCTC GTTCCAGATG       660
     CCGAGCTGGG AAAGCGTGCT GCGCGCCGCC GACATCATGA GCGTGAACCG CGTGTCCATC       720
     GACATCGGCC CCACGCGCCA CGGCATCACG CAGGGCACCA CGATCTACTT CTTCGACCCC       780
     AGCGGCAACC GGCTGGAGAC CTTCTGCGGC GGCTACGACC ACTACCCCGA CATGCACCCC       840
     ATCACCTGGA GCTGGGAGCA CGTGGGGCGC GGCATCTTCT ACCACGACCG CAAGCTCAAC       900
     GACGCCTTCC TGAGCGTGGT GACCTGA                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page