(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE325

ALDEN1_2.PE325       Location/Qualifiers
FT   CDS_pept        364232..365692
FT                   /locus_tag="Alide_0335"
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03216"
FT                   /codon_start="1"
FT                   /product="2-hydroxymuconic semialdehyde dehydrogenase"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0220 betaine-aldehyde dehydrogenase;
FT                   TIGRFAM: 2-hydroxymuconic semialdehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase"
FT                   /db_xref="GI:319761063"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR017628"
FT                   /db_xref="GeneID:10102358"
FT                   /translation="MKEFLNFINGEYVRGTSGKTFDDINPVDGSLIGRIHEAGQGEVNA
FT                   AVAAAQAALKGDWGRLAVVERCKLLDAVAGEINRRFDDFLQAEIADTGKPHHLASHVDI
FT                   PRGAANFQIFIDTIKSTATESFNMRTPDGKTALSYGVRVPRGVIAVVCPWNLPLLLMTW
FT                   KVGPALACGNTVVVKPSEETPATATLLGEVMNAVGMPKGVYNVVHGFGPGSAGEFLTRH
FT                   PGVNGITFTGETRTGSAIMKAAADGVRPVSLEMGGKNAAVVFADCDFQVAVDTLTRSCF
FT                   ENAGQVCLGTERVYVERPIFEKLVAALKERAEAMKPGLPFDKDTKIGPLISKKHQAKVL
FT                   GLYQKAKDEGATIVTGGGIPDMPEALRGGSWVQPTIWTGLPETATVVTEEIFGPCCHIS
FT                   PFDTEEEVLGKVNANRYGLATAVFTQDIARANRLAHQIEVGLCWINAWFLRDLRTPFGG
FT                   SKQSGIGREGGVHSLEFYTELRNVMVKF"
FT                   /protein_id="YP_004125000.1"
     ATGAAAGAGT TTCTCAACTT CATCAACGGC GAGTACGTCA GGGGCACCAG CGGCAAGACG        60
     TTCGACGACA TCAACCCGGT GGACGGCAGC CTCATCGGAC GCATCCACGA GGCCGGCCAG       120
     GGCGAGGTGA ATGCAGCCGT GGCGGCGGCC CAGGCCGCGC TCAAGGGCGA CTGGGGGCGC       180
     CTGGCGGTGG TGGAGCGCTG CAAGCTGCTC GACGCCGTGG CGGGCGAGAT CAACCGCCGT       240
     TTCGACGACT TCCTGCAGGC CGAGATCGCC GACACCGGCA AGCCGCACCA CCTGGCATCG       300
     CACGTGGACA TTCCGCGCGG CGCGGCCAAC TTCCAGATCT TCATCGACAC CATCAAGAGC       360
     ACGGCCACCG AGTCGTTCAA CATGCGCACG CCCGACGGCA AGACGGCGCT GAGTTACGGC       420
     GTGCGCGTGC CGCGCGGCGT GATCGCCGTG GTGTGCCCGT GGAACCTGCC GCTGCTGCTC       480
     ATGACCTGGA AGGTCGGCCC GGCGCTGGCC TGCGGCAACA CCGTGGTCGT CAAGCCGAGC       540
     GAGGAGACGC CGGCCACCGC CACGCTGCTG GGCGAGGTGA TGAACGCCGT GGGCATGCCC       600
     AAGGGCGTGT ACAACGTGGT GCACGGCTTC GGCCCCGGCT CGGCGGGCGA ATTTTTGACC       660
     AGGCACCCGG GCGTGAACGG CATCACCTTC ACGGGCGAGA CGCGCACCGG CAGCGCCATC       720
     ATGAAGGCCG CCGCCGACGG CGTGCGCCCG GTGTCGCTGG AGATGGGTGG CAAGAACGCC       780
     GCCGTGGTGT TCGCCGACTG CGACTTCCAG GTGGCCGTGG ACACGCTCAC GCGCTCGTGC       840
     TTCGAGAACG CGGGCCAGGT CTGCCTGGGC ACCGAGCGCG TGTACGTGGA GCGCCCGATT       900
     TTCGAGAAGC TCGTCGCCGC CTTGAAGGAA CGCGCCGAAG CCATGAAGCC CGGCCTGCCG       960
     TTCGACAAGG ACACGAAGAT CGGCCCGCTC ATCAGCAAGA AGCACCAGGC CAAGGTGCTG      1020
     GGCCTGTACC AGAAGGCCAA GGACGAGGGC GCCACCATCG TCACCGGCGG CGGCATTCCC      1080
     GACATGCCCG AGGCGCTGCG CGGCGGCTCG TGGGTGCAGC CCACCATCTG GACCGGCCTG      1140
     CCCGAGACCG CCACCGTGGT CACCGAGGAA ATCTTCGGCC CCTGCTGCCA CATCAGCCCC      1200
     TTCGATACCG AGGAAGAGGT GCTGGGCAAG GTGAACGCCA ACCGCTACGG CCTGGCCACG      1260
     GCCGTGTTCA CGCAGGACAT CGCGCGCGCC AACCGCCTGG CGCACCAGAT CGAGGTCGGC      1320
     CTGTGCTGGA TCAACGCCTG GTTCCTGCGC GACCTGCGCA CGCCCTTCGG CGGCTCCAAG      1380
     CAGTCCGGCA TCGGCCGCGA GGGCGGCGTG CACTCGCTGG AGTTCTATAC CGAGCTGCGC      1440
     AACGTGATGG TGAAGTTTTG A                                                1461
//

If you have problems or comments...

PBIL Back to PBIL home page