(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE326

ALDEN1_2.PE326       Location/Qualifiers
FT   CDS_pept        365754..366617
FT                   /locus_tag="Alide_0336"
FT                   /gene_family="HOG000028063" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   ctt:CtCNB1_3150 alpha/beta hydrolase fold protein"
FT                   /db_xref="GI:319761064"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="GeneID:10102359"
FT                   /translation="MTDTARNPELAHTIAAAGLRTNYHDVGQGDPVLLIHGSGPGVSAW
FT                   ANWRLVMPALAERARVIAPDMAGFGYSERPAGFAYGLDAWVRQAVGLLDALGIARADLV
FT                   GNSFGGGLALALAIRHPERVRRLVLMGSVGVPFAITPGLDAVWGYEPSFEAMRALLDIF
FT                   AFDRALVNDELARLRYEASIRPGFHESFAAMFPAPRQRWVDALASRESDIRRLPHETLV
FT                   IHGREDRVIPLANAYTLADWLPRAQLHVYGRCGHWTQIEHAARFARLVGGFLAEAAADE
FT                   PLPLAA"
FT                   /protein_id="YP_004125001.1"
     ATGACCGACA CCGCACGTAA CCCGGAGCTG GCGCACACCA TCGCCGCCGC GGGCCTACGC        60
     ACCAACTACC ACGACGTGGG GCAGGGCGAT CCGGTGCTGC TCATCCACGG CTCGGGCCCG       120
     GGCGTGTCGG CCTGGGCCAA CTGGCGCCTG GTGATGCCCG CGCTCGCCGA GCGTGCGCGC       180
     GTCATCGCGC CGGACATGGC GGGCTTTGGC TACAGCGAGC GCCCGGCCGG CTTTGCCTAC       240
     GGGCTGGACG CCTGGGTGCG CCAGGCCGTG GGCCTGCTGG ACGCACTGGG CATCGCGCGC       300
     GCCGACCTCG TGGGCAACTC CTTCGGCGGC GGCCTGGCGC TGGCGCTGGC CATCCGCCAC       360
     CCCGAGCGCG TGCGCCGCCT GGTGCTCATG GGCAGCGTGG GCGTGCCGTT CGCCATCACG       420
     CCGGGGCTGG ATGCGGTGTG GGGCTACGAG CCGTCCTTCG AGGCCATGCG CGCGCTGCTG       480
     GACATCTTCG CCTTCGACCG TGCGCTGGTG AACGACGAAC TCGCGCGCCT GCGCTACGAG       540
     GCCAGCATCC GCCCGGGCTT TCACGAATCG TTTGCCGCCA TGTTCCCCGC GCCGCGCCAG       600
     CGCTGGGTGG ATGCGCTGGC GAGCCGCGAG AGCGACATCC GCCGCCTGCC GCACGAGACC       660
     CTGGTCATCC ACGGCCGCGA GGACCGCGTG ATACCGCTGG CCAACGCCTA TACGCTGGCC       720
     GACTGGCTGC CGCGCGCACA GCTGCACGTC TACGGCCGCT GCGGCCACTG GACGCAGATC       780
     GAGCACGCGG CGCGCTTCGC CCGCCTGGTG GGCGGCTTCC TGGCCGAAGC CGCCGCCGAC       840
     GAACCCCTTC CCCTAGCCGC TTGA                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page