(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE329

ALDEN1_2.PE329       Location/Qualifiers
FT   CDS_pept        368352..369389
FT                   /locus_tag="Alide_0339"
FT                   /gene_family="HOG000048047" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03217"
FT                   /codon_start="1"
FT                   /product="4-hydroxy-2-oxovalerate aldolase"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0224 4-hydroxy-2-ketovalerate
FT                   aldolase; TIGRFAM: 4-hydroxy-2-oxovalerate aldolase; PFAM:
FT                   pyruvate carboxyltransferase; DmpG communication domain
FT                   protein"
FT                   /db_xref="GI:319761067"
FT                   /db_xref="GO:0008701"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="GeneID:10102362"
FT                   /translation="MTFNGKKITLHDMTLRDGMHPKRHLMTLEQMKSVAQGLDAAGVPL
FT                   IEVTHGDGLGGASVNYGFPAHSDEEYLGTVIPLMKQAKVSALLLPGIGTVDHLKMAHGL
FT                   GVHTIRVATHCTEADVSEQHITAARKLDMDTVGFLMMAHMNSASGLVKQARLMEGYGAN
FT                   CIYVTDSAGYLLPEQVKERIAAVRAALKPETELGFHGHHNLAMGVANSIAAIEAGANRI
FT                   DAAAAGLGAGAGNTPMEVLVAVLDRMGLQTGVDVWKIQDVAEDLVVPLMDFPIRIDRDA
FT                   LTLGYAGVYGSFLLFAKRAEKKYGIPARDLLVELGRRGMVGGQEDMIEDTALTMARERG
FT                   IKVAA"
FT                   /protein_id="YP_004125004.1"
     ATGACATTCA ACGGCAAGAA AATCACCCTG CACGACATGA CGCTGCGCGA CGGCATGCAC        60
     CCCAAGCGCC ACCTGATGAC GCTGGAGCAG ATGAAAAGCG TGGCCCAGGG CCTGGACGCG       120
     GCCGGCGTGC CGCTGATCGA GGTCACCCAC GGCGACGGCC TGGGCGGCGC ATCGGTCAAC       180
     TACGGCTTTC CCGCGCACAG CGACGAGGAA TACCTGGGCA CCGTGATCCC GCTCATGAAG       240
     CAGGCCAAGG TCAGCGCCCT GCTGCTGCCC GGCATCGGCA CCGTGGACCA CCTGAAGATG       300
     GCGCACGGCC TGGGCGTGCA CACCATCCGC GTGGCCACGC ACTGCACCGA GGCCGACGTG       360
     AGCGAGCAGC ACATCACGGC CGCGCGCAAG CTGGACATGG ACACCGTGGG CTTCCTGATG       420
     ATGGCGCACA TGAACTCTGC CTCCGGCCTG GTCAAGCAGG CCCGGCTGAT GGAGGGCTAC       480
     GGCGCCAACT GCATCTACGT CACCGACTCC GCCGGCTACC TGCTGCCCGA GCAGGTGAAG       540
     GAGCGCATCG CCGCCGTGCG CGCCGCGCTC AAGCCCGAGA CCGAGCTGGG CTTCCATGGC       600
     CACCACAACC TGGCCATGGG CGTGGCCAAC TCCATCGCCG CGATCGAAGC CGGCGCGAAC       660
     CGCATCGACG CCGCTGCCGC CGGCCTGGGC GCGGGCGCGG GCAACACGCC CATGGAGGTG       720
     CTGGTGGCCG TGCTCGACCG CATGGGCCTG CAGACCGGCG TGGACGTGTG GAAGATCCAG       780
     GACGTGGCCG AGGACCTGGT GGTGCCGCTG ATGGACTTCC CCATCCGCAT CGACCGCGAC       840
     GCGCTCACGC TGGGCTACGC CGGCGTGTAC GGCAGCTTCC TGCTGTTCGC CAAGCGCGCC       900
     GAGAAGAAGT ACGGCATCCC CGCGCGCGAC CTGCTCGTGG AGCTGGGCCG GCGCGGCATG       960
     GTCGGCGGCC AGGAAGACAT GATCGAGGAC ACGGCCCTGA CCATGGCGCG CGAGCGCGGC      1020
     ATCAAGGTCG CCGCCTGA                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page