(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE33

ALDEN1_2.PE33        Location/Qualifiers
FT   CDS_pept        41657..41908
FT                   /locus_tag="Alide_0033"
FT                   /gene_family="HOG000280481" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0031"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0031 hypothetical protein"
FT                   /db_xref="GI:319760771"
FT                   /db_xref="GeneID:10102056"
FT                   /translation="MTDSALIPLPDHLAVDPRSPHHVAAVFQQQADIGIRFNGKERFDV
FT                   EEYCVSEGWIKVPAGKTLDRRGRPLLITLKGSVEAFYK"
FT                   /protein_id="YP_004124708.1"
     GTGACCGATT CCGCCCTGAT CCCCCTGCCC GACCATCTGG CCGTAGACCC GCGCAGCCCC        60
     CACCACGTGG CGGCCGTGTT CCAGCAGCAA GCCGACATAG GCATCCGCTT CAACGGCAAG       120
     GAGCGCTTCG ACGTGGAGGA GTACTGTGTG AGCGAGGGCT GGATCAAGGT GCCCGCGGGC       180
     AAGACGCTGG ACCGCAGGGG GCGGCCGCTG CTTATCACGC TCAAGGGGAG CGTGGAGGCG       240
     TTTTACAAGT AG                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page