(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE331

ALDEN1_2.PE331       Location/Qualifiers
FT   CDS_pept        370252..371220
FT                   /locus_tag="Alide_0341"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CtCNB1_3145"
FT                   /codon_start="1"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /transl_table="11"
FT                   /note="KEGG: ctt:CtCNB1_3145 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="GI:319761069"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="GeneID:10102364"
FT                   /translation="MQRRDFMAAAALAGLAPAWAQAGYPAKPVRMIVPFPPGGPTDVMG
FT                   RTAAKAMGDRLGQQFVVENKAGAGGNIGTDAVAKAAPDGYTIGLTAISSLAIAPHLYSS
FT                   VPFNVEKDFVPISLVGTTPCALVIHPAAPFSDLKGMVAYAKANPGKLSYATSGIGTSNH
FT                   LAAELLQSVAGIQLTGVPYKGSSQIVPDLLSGTVMMSMESSLATTLQHVRAGKLKAIAV
FT                   TSPQRAKALPDVPTVAESGYPGFEVETWFGLVAPARTPQAVVDKLHDAWAAGSAAPEAR
FT                   AAFDNISGNLRVTTPQQFAEFIRAENRRWGDLIRKLGIKAD"
FT                   /protein_id="YP_004125006.1"
     ATGCAGCGAA GAGACTTCAT GGCCGCCGCC GCGCTGGCGG GCCTGGCCCC GGCCTGGGCG        60
     CAGGCCGGCT ATCCCGCCAA GCCCGTGCGC ATGATCGTGC CGTTCCCGCC CGGCGGGCCG       120
     ACCGACGTCA TGGGCCGCAC GGCGGCCAAG GCCATGGGCG ACAGGCTGGG CCAGCAGTTC       180
     GTGGTCGAGA ACAAGGCCGG CGCGGGCGGC AACATCGGCA CCGACGCCGT GGCCAAGGCC       240
     GCGCCCGACG GCTACACCAT CGGCCTCACG GCCATCAGCA GCCTGGCCAT CGCGCCGCAC       300
     CTGTACAGCA GCGTGCCGTT CAACGTCGAG AAGGACTTCG TGCCCATCTC GCTCGTGGGC       360
     ACCACGCCGT GCGCGCTCGT CATCCACCCG GCGGCGCCGT TCTCGGACCT CAAGGGCATG       420
     GTGGCCTATG CCAAGGCCAA CCCCGGCAAG CTCAGCTATG CCACGTCCGG CATCGGCACC       480
     AGCAACCACC TGGCGGCCGA GCTGCTGCAG TCGGTGGCCG GCATCCAGCT CACCGGCGTG       540
     CCGTACAAGG GCTCGAGCCA GATCGTGCCC GACCTGCTCT CGGGCACCGT CATGATGAGC       600
     ATGGAAAGCT CGCTCGCCAC CACCTTGCAG CATGTCAGGG CGGGCAAGCT CAAGGCCATC       660
     GCGGTCACGT CGCCGCAGCG CGCCAAGGCG CTGCCCGACG TGCCCACGGT GGCCGAGTCC       720
     GGCTACCCCG GCTTCGAGGT CGAGACCTGG TTCGGCCTGG TCGCGCCGGC GCGCACGCCG       780
     CAGGCCGTCG TGGACAAGCT GCACGACGCC TGGGCCGCGG GCTCCGCCGC GCCCGAGGCG       840
     CGCGCCGCCT TCGACAACAT CTCGGGCAAC CTGCGCGTGA CCACGCCGCA GCAGTTCGCC       900
     GAGTTCATCC GCGCCGAGAA CCGGCGCTGG GGCGACCTGA TCCGCAAGCT CGGCATCAAG       960
     GCCGACTGA                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page