(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE332

ALDEN1_2.PE332       Location/Qualifiers
FT   CDS_pept        371247..371438
FT                   /locus_tag="Alide_0342"
FT                   /gene_family="HOG000077848" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00013"
FT                   /codon_start="1"
FT                   /product="4-oxalocrotonate tautomerase family enzyme"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0227 4-oxalocrotonate tautomerase;
FT                   TIGRFAM: 4-oxalocrotonate tautomerase family enzyme; PFAM:
FT                   4-oxalocrotonate tautomerase"
FT                   /db_xref="GI:319761070"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="GeneID:10102365"
FT                   /translation="MPFAQIYMIEGRTEEQKKAVIEKVTQALVDAVGAPPANVRVWIHD
FT                   VPKENWGIAGVSAKELGR"
FT                   /protein_id="YP_004125007.1"
     ATGCCATTCG CACAGATCTA CATGATCGAA GGCCGCACCG AGGAGCAGAA GAAGGCCGTG        60
     ATCGAGAAGG TCACCCAGGC CCTCGTCGAT GCCGTGGGCG CGCCGCCGGC CAACGTGCGC       120
     GTCTGGATCC ACGACGTGCC CAAGGAGAAC TGGGGCATCG CGGGCGTCAG CGCCAAGGAA       180
     CTGGGGCGCT GA                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page