(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE334

ALDEN1_2.PE334       Location/Qualifiers
FT   CDS_pept        complement(372207..372959)
FT                   /locus_tag="Alide_0344"
FT                   /gene_family="HOG000107041" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /codon_start="1"
FT                   /product="regulatory protein iclr"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_4281 IclR family transcriptional
FT                   regulator; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:319761072"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:10102367"
FT                   /translation="MSNPPAPSKPADGGVIAVTRALQLLEAFAVGESHLSLAELSRRAG
FT                   LHKTTVLRLARTLAQSGYMVQREDGDWRLGPAAGWLGARYQAGFDVQNVLEPALRELTQ
FT                   TSGESAAFYVREGNVRTCLVRVEGPQALRHHARMGEGLPLDKGSPGRVILAFSGEPGEV
FT                   YEEIRRRGYHWSIGEREQGVATVSAPVFGRNWRLLGCVCISGPQSRLPQEKLEALAQTI
FT                   IKTANQLSYALAGKAASTAAQVPGVWHP"
FT                   /protein_id="YP_004125009.1"
     atgagcaacc ccccagcccc ctcgaagccc gccgacggcg gcgtgatcgc cgtcacccgc        60
     gccctgcaac tgctcgaagc cttcgcggta ggcgaatcgc acctgtcgct ggcggagctc       120
     agccgccgcg caggcctgca caagaccaca gtgctgcgcc tggcgcgtac gctggcgcag       180
     tcgggctaca tggtccagcg cgaggacggc gactggcgcc tgggcccggc cgcgggctgg       240
     ctgggcgcgc gctaccaggc gggcttcgac gtgcagaacg tgctggagcc cgcgctgcgc       300
     gaactcacgc agaccagcgg cgagagcgcg gccttctacg tgcgcgaggg caacgtgcgc       360
     acctgcctcg tgcgcgtgga aggcccgcag gcgctgcgcc accacgcgcg catgggcgag       420
     gggctgccgc tggacaaggg ctcgccgggg cgcgtgatcc tggcgttctc gggcgagccg       480
     ggcgaggtct acgaggagat ccgccggcgg ggctaccact ggtcgatcgg cgagcgcgag       540
     cagggcgtgg ccaccgtgtc ggcccccgtc ttcgggcgca actggcggct gctgggctgc       600
     gtgtgcatct cgggcccgca gtcgcggctg ccgcaggaaa agctggaggc gctggcgcag       660
     accatcatca agacggcgaa ccagctgtcc tacgcgctgg ccggcaaggc ggccagcacg       720
     gcggcgcagg tgccgggcgt ctggcatccg tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page