(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE335

ALDEN1_2.PE335       Location/Qualifiers
FT   CDS_pept        373084..374064
FT                   /locus_tag="Alide_0345"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Daci_4280"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_4280 hypothetical protein"
FT                   /db_xref="GI:319761073"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102368"
FT                   /translation="MLARTLSRSLCAAALGLAAATGALAQAAYPAKPIRLIVPFPPGGG
FT                   TDMIARTVAQKVADQNKWSVIVDNRPGAGGNLGVDAAAKAAPDGYTLVMGQTSNLAINP
FT                   TLYPRLPYDPLKDLVPVALVSSSPIVMAAPANTPFKTFADVVAAAKKQPDGITLGYSGN
FT                   GTVAHLAGELAENAAGIKLRHIPYKGAAQAMTDLVSGQIDLYMSSVPTLLGQVRNGKLR
FT                   PIVVTSLKRSAQLPDTPSLAESGYRGFDAVTWFGVLAPAGTPASIVQQLNKAINEALKQ
FT                   PEVAEKLRSEGGDVLGGTPEQFDQLLRAEVPRWGKIVKDSGASLD"
FT                   /protein_id="YP_004125010.1"
     ATGCTTGCAC GCACCCTCTC GCGCTCGCTG TGCGCCGCCG CGCTCGGCCT TGCTGCCGCC        60
     ACCGGCGCAC TGGCGCAGGC CGCCTACCCG GCCAAGCCGA TACGCCTCAT CGTGCCGTTC       120
     CCGCCCGGCG GCGGCACCGA CATGATCGCG CGCACCGTGG CGCAGAAGGT CGCCGACCAG       180
     AACAAGTGGA GCGTGATCGT GGACAACCGC CCCGGCGCCG GCGGCAACCT GGGTGTGGAC       240
     GCGGCGGCCA AGGCCGCGCC CGACGGCTAC ACGCTCGTCA TGGGCCAGAC GAGCAACCTC       300
     GCGATCAACC CCACGCTGTA CCCCAGGCTG CCCTACGACC CGCTCAAGGA CCTGGTGCCG       360
     GTGGCGCTCG TTTCGTCCTC GCCCATCGTG ATGGCCGCGC CGGCGAACAC GCCGTTCAAG       420
     ACCTTCGCCG ACGTGGTGGC CGCCGCCAAG AAGCAGCCCG ACGGCATCAC GCTGGGCTAC       480
     TCGGGCAACG GCACGGTGGC GCACCTGGCC GGCGAGCTCG CGGAGAACGC GGCCGGCATC       540
     AAGCTGCGCC ACATCCCCTA CAAGGGCGCG GCCCAGGCCA TGACCGACCT GGTGAGCGGG       600
     CAGATCGACC TGTACATGTC CTCGGTGCCC ACGCTGCTGG GCCAGGTGCG CAACGGCAAG       660
     CTGCGGCCCA TCGTCGTCAC CTCCCTCAAG CGTTCGGCCC AGCTGCCCGA CACGCCGTCG       720
     CTGGCCGAGT CGGGCTATCG TGGCTTCGAC GCCGTGACCT GGTTTGGCGT CCTCGCTCCC       780
     GCGGGCACGC CCGCCTCGAT AGTGCAGCAG CTCAACAAGG CCATCAACGA GGCCCTGAAG       840
     CAGCCCGAAG TGGCCGAGAA GCTGCGCTCC GAAGGCGGCG ACGTGCTGGG CGGCACGCCC       900
     GAGCAGTTCG ACCAGCTTCT GCGCGCCGAG GTGCCGCGCT GGGGCAAGAT CGTCAAGGAC       960
     TCGGGCGCGA GCCTCGATTG A                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page