(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE336

ALDEN1_2.PE336       Location/Qualifiers
FT   CDS_pept        374072..374944
FT                   /locus_tag="Alide_0346"
FT                   /gene_family="HOG000107488" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /codon_start="1"
FT                   /product="amidohydrolase 2"
FT                   /transl_table="11"
FT                   /note="PFAM: amidohydrolase 2; KEGG: dac:Daci_4279
FT                   amidohydrolase 2"
FT                   /db_xref="GI:319761074"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="GeneID:10102369"
FT                   /translation="MREPVAFSAGTGTPGVALPAGACDCHVHVYDRRYPAAPGAKLLPP
FT                   DASAHDYRALQRRLGTTRAVLVTPSTYGTDNRCMLDGLAALGPQARGVAVIGGGEIDAE
FT                   LQRLHDAGVRGVRLNLSLGVSGTADMLEPLARRIAPLGWHLQLLMAPELLAAQAGVLRR
FT                   LPVPLVFDHFGRIAPGAQGQAAHALLLELLQAGRAWIKLSGGYIVSALHTVEDPALDPL
FT                   AASYLRCAPERVLWGSDWPHATASAGLQPMPDDARQIDRLHDWTRLAFVPLRRVLVDNP
FT                   QALYGFPPL"
FT                   /protein_id="YP_004125011.1"
     ATGCGCGAGC CCGTCGCTTT CTCGGCCGGC ACCGGCACGC CGGGCGTGGC GCTGCCCGCC        60
     GGCGCCTGCG ACTGCCACGT GCACGTGTAC GACCGCCGCT ACCCCGCTGC CCCCGGCGCG       120
     AAGCTGCTGC CGCCCGACGC CTCGGCGCAT GACTACCGGG CGCTGCAGCG GCGCCTCGGC       180
     ACCACGCGCG CGGTGCTGGT CACGCCGTCC ACCTACGGCA CCGACAACCG CTGCATGCTC       240
     GACGGCCTGG CCGCGCTCGG CCCCCAGGCG CGTGGCGTGG CCGTGATCGG GGGTGGCGAG       300
     ATCGACGCCG AGCTGCAGCG CCTGCACGAT GCCGGCGTGC GCGGCGTGCG GCTGAACCTG       360
     TCGCTGGGCG TGTCGGGTAC GGCGGACATG CTGGAGCCGC TGGCGCGCCG CATCGCGCCG       420
     CTGGGCTGGC ACCTGCAGCT GCTGATGGCG CCCGAGCTGC TCGCGGCGCA GGCCGGCGTG       480
     CTGCGGCGCC TGCCCGTGCC GCTGGTGTTC GACCACTTCG GGCGCATCGC GCCGGGCGCG       540
     CAGGGGCAGG CGGCGCACGC GCTGCTGCTG GAGCTGCTGC AGGCCGGGCG GGCGTGGATC       600
     AAGCTCTCGG GTGGCTACAT CGTGAGCGCG CTGCACACGG TGGAAGACCC CGCGCTCGAC       660
     CCGCTGGCCG CGAGCTACCT GCGCTGCGCG CCCGAGCGCG TGCTCTGGGG CAGCGACTGG       720
     CCCCACGCCA CCGCCTCGGC CGGGTTGCAG CCCATGCCCG ACGACGCGCG GCAGATCGAC       780
     CGCCTGCACG ACTGGACGCG TCTGGCCTTT GTGCCGCTGC GGCGCGTGCT GGTGGACAAC       840
     CCGCAGGCGC TCTACGGCTT TCCCCCTCTT TGA                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page