(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE339

ALDEN1_2.PE339       Location/Qualifiers
FT   CDS_pept        376672..377589
FT                   /locus_tag="Alide_0349"
FT                   /gene_family="HOG000136700" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /codon_start="1"
FT                   /product="d-isomer specific 2-hydroxyacid dehydrogenase
FT                   nad-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: vap:Vapar_5586 D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding"
FT                   /db_xref="GI:319761077"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="GeneID:10102372"
FT                   /translation="MSRPAILITAADLAPQALALLADYEIVYAGRSPTEDDIVALCRRH
FT                   DPVAIIVRYSKVGAAAMDAAPSLKVISKHGSGTDTIDKAAAKVRGIEVVAAVGANAAAV
FT                   AEQALALLLACAKSVPQLNERMHAGHWDKATHKSLELSGRTIGLIGLGAIGLRFAKMVD
FT                   ALGMHVLGFDPFAKNLPDYVQPADLETIWRESDAISLHCPLTDDNRHLLGAGTLARCKQ
FT                   GVIVVNTARGGLIDEAALLAAVQSGQVRMAGLDSFAVEPMTAGHPFQHQPGFILSPHIG
FT                   GVTSDAYVNMGLGAARNALAVLAR"
FT                   /protein_id="YP_004125014.1"
     GTGAGCCGCC CCGCCATCCT CATCACGGCG GCCGACCTCG CGCCCCAGGC GCTCGCGCTG        60
     CTGGCTGACT ACGAAATCGT CTACGCCGGC CGGTCGCCCA CCGAGGACGA CATCGTCGCC       120
     CTGTGCCGCC GGCACGACCC CGTGGCCATC ATCGTGCGCT ACAGCAAGGT GGGCGCGGCG       180
     GCCATGGACG CGGCGCCGTC GCTCAAGGTG ATCTCCAAGC ACGGCAGCGG CACCGACACC       240
     ATCGACAAGG CGGCCGCGAA GGTACGCGGC ATCGAGGTGG TGGCCGCCGT GGGCGCCAAC       300
     GCCGCCGCCG TGGCCGAGCA GGCGCTGGCG CTGCTGCTGG CTTGCGCCAA GTCCGTGCCC       360
     CAGCTCAACG AGCGCATGCA CGCGGGCCAC TGGGACAAGG CCACGCACAA GAGCCTGGAG       420
     CTCTCTGGCC GCACCATCGG CCTCATCGGC CTGGGCGCCA TCGGCCTGCG CTTCGCGAAG       480
     ATGGTGGATG CGCTGGGCAT GCACGTGCTT GGCTTCGACC CTTTCGCCAA GAACCTGCCC       540
     GACTACGTGC AGCCCGCCGA CCTGGAAACG ATCTGGCGCG AGAGCGACGC GATTTCGCTG       600
     CACTGCCCGC TGACCGACGA CAACCGCCAC CTGCTGGGCG CCGGCACGCT GGCACGCTGC       660
     AAGCAGGGCG TGATCGTAGT GAACACCGCG CGCGGCGGCT TGATCGACGA GGCCGCGCTG       720
     CTCGCCGCCG TGCAGAGCGG CCAGGTGCGC ATGGCGGGGC TGGACAGCTT CGCCGTGGAG       780
     CCCATGACTG CCGGCCATCC GTTCCAGCAC CAGCCGGGTT TCATCCTCAG CCCGCACATC       840
     GGCGGCGTGA CCAGCGACGC CTACGTGAAC ATGGGCCTGG GCGCCGCGCG CAACGCGCTG       900
     GCCGTGCTGG CGCGCTGA                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page