(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE34

ALDEN1_2.PE34        Location/Qualifiers
FT   CDS_pept        complement(41877..43754)
FT                   /locus_tag="Alide_0034"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Balat_0053"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: blt:Balat_0053 beta-galactosidase I"
FT                   /db_xref="GI:319760772"
FT                   /db_xref="GeneID:10102057"
FT                   /translation="MNFLLRSAAALLCSLFVGGAATAKPQVATLIVMPQDLRQNPQIVS
FT                   DLQRRGINHATVYLTWADVEAQPGHFDFSAYDPYFDQLTQGGLSLVVVLDMGGRAYFDG
FT                   TGKHFPGRTTVPEWLYRQVPDGFMKNFSGQSTPQPDFMNPTVRQFSAQFVRNAVAHLSQ
FT                   RYPGKVTAYSIGLQEEHEIKYGQTGYQWRDYADAAQAAFRQQTGAPLPVINYTSDIALG
FT                   LPRTEPLLHAHKQFREANLKEATCFYADAIRSQGGRAMSYFGELFTAHDGIYATSVAEQ
FT                   LADCLDIAVIDYNFYDGYSLSPDARVLPMLANYMASVGYKQIMVGAYAEQWERVKKSTE
FT                   LLPVISRTLSTALAQPNVIGYEVGGLQRQLDTHLTGTVDLDKLQALRVQPPVPATASTG
FT                   KKLTVGILASTSNYYVWHGDRSGGVNVHREALLEAYNLLSTQPGFDVHVIGEKNLQEDD
FT                   LLQRLNAIVVPHQAALPASIKQQLKVYWKKGGTLVQDMRLGEFDENGKPVYDWMHEVFG
FT                   IENITWRPRGGIFLTDDGQILRLKPARKLYTGYAAMTPRPGYRLLATDILNKRQGIMVR
FT                   GERTLVFGFTPQLVEDATQAMWQQIFVREIANAVRCPTPTTCKTPPRSP"
FT                   /protein_id="YP_004124709.1"
     atgaacttcc ttctccgctc agccgcagca ctgctgtgct ctctgtttgt cggcggtgct        60
     gcaactgcca agccgcaggt ggccaccctc atcgtcatgc cccaggatct gcgtcagaac       120
     ccgcagatcg tcagcgacct acagcgccga ggcatcaacc acgccacggt gtaccttacc       180
     tgggccgacg tcgaagcaca gccgggccat ttcgacttct cggcctacga cccgtacttc       240
     gaccagctca cccagggtgg actatcgctt gtcgtcgtgc tcgacatggg gggccgcgcg       300
     tacttcgatg gaacgggcaa gcatttcccc ggccgcacca ccgtgcctga atggctgtac       360
     aggcaggtgc ccgatgggtt tatgaagaac ttctcgggcc agtccacgcc gcagcccgac       420
     ttcatgaacc ccacggtgcg ccagttctcg gcccagttcg tgcgcaatgc cgtggcccat       480
     ctctcgcagc gctatcccgg gaaggtcacg gcctactcca tcggcctgca agaagagcat       540
     gaaatcaaat acggccagac cggctaccag tggcgcgact acgccgacgc cgcgcaggct       600
     gccttccgcc agcaaacggg cgcaccgctg cccgtcatca actacaccag cgacattgcc       660
     ctgggcctgc ccaggacgga gccgctgctg cacgcgcaca agcagttccg cgaagcgaat       720
     ctgaaggagg ccacctgctt ctacgccgac gccatccgca gccagggcgg ccgcgccatg       780
     agctactttg gcgaactctt caccgcgcac gacggcatct acgccaccag cgtggccgag       840
     caactggccg actgcctgga cattgccgtc atcgactaca acttctacga cgggtacagc       900
     ttgtcgcccg acgcgcgcgt gctgcccatg ctggccaact acatggcctc ggtgggctac       960
     aagcagatca tggtgggcgc ctatgccgag cagtgggagc gcgtgaaaaa atccaccgaa      1020
     ctcctgcccg tcatcagccg caccctgtcc accgcgctgg cgcagccgaa cgtgatcggc      1080
     tacgaggtgg gcggtctgca gcgccaactc gacacgcacc tcaccggcac ggtggatctc      1140
     gataagctcc aggccctgcg cgtgcagccc cccgtgcccg ccactgccag cacgggaaag      1200
     aagctcaccg tgggcatcct cgcctccacc agcaactact acgtatggca cggggaccgc      1260
     agcggcggcg tcaacgtgca ccgcgaggcg ctgctcgaag cctacaacct cctgagcacg      1320
     cagccgggct tcgacgtcca cgtcatcggt gaaaagaacc tgcaggaaga cgatctgctg      1380
     cagcgcctga acgccatcgt agttccacac caagccgccc tgcccgcatc catcaagcag      1440
     cagctcaagg tctactggaa aaagggcggc acgctggtcc aggacatgcg ccttggcgaa      1500
     ttcgatgaga acggcaaacc cgtctacgac tggatgcacg aggttttcgg catcgagaac      1560
     attacgtgga ggccgcgcgg cggcatcttc ctgacggacg acggccagat cctgcgcctg      1620
     aaacctgcgc gcaagctgta cacgggctac gcggccatga ccccgcgtcc tggctatcgc      1680
     ctgctggcca ccgacatcct caacaagcgc caaggcatca tggtgcgtgg cgaacggacg      1740
     ctggtgttcg gcttcacgcc gcaattggtc gaagatgcca cccaggccat gtggcagcag      1800
     attttcgtgc gcgaaatcgc caacgccgtg cgatgcccca cgcccactac ttgtaaaacg      1860
     cctccacgct ccccttga                                                    1878
//

If you have problems or comments...

PBIL Back to PBIL home page