(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE340

ALDEN1_2.PE340       Location/Qualifiers
FT   CDS_pept        377614..378603
FT                   /locus_tag="Alide_0350"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Vapar_3894"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: vap:Vapar_3894 hypothetical protein"
FT                   /db_xref="GI:319761078"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102373"
FT                   /translation="MQFNKNRRLALIHQALAAIALVATGLPVQAQNWPERPIKLVVPYP
FT                   AGGNADNTARLLATQLSARLGQQVVVDNRPGGSGTIGAAAVAKAAPDGYTLLLDATAFT
FT                   VNPSLFAKLPFDAAKDFAPISLVMQAPLLLVVPAVSPLKTVADLVQAAKARPGQLTYAS
FT                   AGNGGAQHLAGELFKQGAKVSMTHIPYRGGAPALTDLIGGQVDLMFSATTASGPFVKSG
FT                   KLRALAISSVQRTPGWEQVPTVAEAGLPGFQVNEWNGLFAPAGTPQPVLQRLEAETRAI
FT                   VASPEMKKRFAELGVQGVGSSAQEFKSFVQTETAKWAGVIRTSGIRMD"
FT                   /protein_id="YP_004125015.1"
     ATGCAATTCA ATAAGAATCG GCGCCTGGCG CTTATCCATC AGGCACTGGC AGCTATTGCT        60
     TTGGTAGCGA CAGGTCTGCC GGTGCAGGCA CAGAACTGGC CCGAGCGGCC CATCAAGCTC       120
     GTCGTGCCGT ACCCGGCCGG CGGCAATGCC GACAACACCG CGCGGCTGCT GGCCACGCAG       180
     CTGTCGGCCC GCCTGGGCCA GCAGGTGGTG GTGGACAACC GCCCGGGTGG CAGCGGCACC       240
     ATCGGCGCGG CGGCCGTCGC CAAGGCCGCG CCCGACGGCT ACACGCTGCT GCTGGACGCC       300
     ACGGCCTTCA CCGTCAACCC CAGCCTGTTC GCCAAGCTGC CGTTCGACGC GGCCAAGGAC       360
     TTCGCGCCCA TCTCGCTCGT CATGCAGGCG CCGCTGCTGC TGGTGGTGCC CGCCGTGTCG       420
     CCGCTCAAGA CCGTGGCCGA CCTGGTGCAG GCCGCCAAGG CCCGGCCGGG GCAGCTCACC       480
     TACGCATCGG CCGGCAACGG CGGCGCGCAG CACCTGGCGG GCGAGCTGTT CAAGCAGGGC       540
     GCCAAGGTGT CCATGACGCA CATTCCCTAC CGCGGCGGCG CGCCCGCGCT CACCGACCTG       600
     ATCGGTGGCC AGGTGGACCT GATGTTCAGC GCCACCACGG CCAGCGGCCC GTTCGTCAAA       660
     AGCGGCAAGC TGCGCGCGCT GGCCATCAGC TCCGTCCAGC GCACGCCGGG CTGGGAGCAG       720
     GTGCCCACGG TGGCCGAAGC GGGCCTGCCG GGCTTCCAGG TCAACGAATG GAACGGCCTG       780
     TTCGCACCCG CGGGCACGCC GCAGCCGGTG CTGCAGCGCC TGGAAGCCGA GACCCGCGCC       840
     ATCGTCGCCA GCCCCGAGAT GAAGAAGCGC TTCGCCGAAC TGGGCGTGCA GGGCGTGGGG       900
     TCGAGCGCGC AGGAGTTCAA GTCCTTCGTG CAGACCGAGA CCGCCAAATG GGCCGGCGTG       960
     ATCCGCACCA GCGGCATTCG CATGGATTGA                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page