(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE341

ALDEN1_2.PE341       Location/Qualifiers
FT   CDS_pept        378950..379906
FT                   /locus_tag="Alide_0351"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Daci_4274"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_4274 hypothetical protein"
FT                   /db_xref="GI:319761079"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102374"
FT                   /translation="MKSLKKYLLAACACIALAAHAAFPERPITIVVPYAPGGAADAVAR
FT                   VIASRLGTRLGGSVIVDNKAGASGTIGAGYVAKAQADGYTMLYDATPYSINPHLFPKMP
FT                   YAANALQPLSLVLLAPNVLIVPASAPFKSVGDLIAKAKAEPGKLNFASGGSGTVQRLAA
FT                   ELFRQKLGLDMVHVPYKSGGPAITDVMAGQVDFMFGTVAATAPHIAAGKLRALAVSSPE
FT                   RSRRLPDVPTVAEAAIPGYEAYEWNGMFLPAGTPAPIAAQLHKALAEVLQEDEVRQRLA
FT                   DMGAQPIGSTPAEFAAFLKKEDAKWGEVVRKGHIKLD"
FT                   /protein_id="YP_004125016.1"
     ATGAAATCCC TCAAGAAATA CCTGTTGGCC GCCTGTGCCT GCATCGCCCT CGCCGCGCAC        60
     GCCGCGTTCC CCGAGCGGCC CATCACCATC GTCGTGCCCT ACGCGCCGGG CGGCGCGGCC       120
     GATGCCGTGG CCCGCGTGAT CGCCAGCCGC CTGGGCACCA GGCTCGGCGG CAGCGTGATC       180
     GTGGACAACA AGGCCGGCGC CAGCGGCACC ATTGGCGCGG GCTACGTGGC CAAGGCGCAG       240
     GCCGACGGCT ACACCATGCT CTACGACGCC ACGCCGTATT CCATCAACCC GCATCTGTTC       300
     CCCAAGATGC CGTATGCGGC CAACGCGCTG CAGCCGCTGT CGCTGGTGCT GCTGGCACCC       360
     AACGTGCTGA TCGTGCCGGC CAGCGCGCCG TTCAAGAGCG TGGGCGATCT CATCGCCAAG       420
     GCCAAGGCGG AGCCGGGCAA GCTCAACTTT GCCTCGGGCG GCAGCGGCAC GGTGCAGCGC       480
     CTGGCGGCGG AGCTTTTCCG CCAGAAGCTC GGCCTGGACA TGGTGCACGT GCCCTACAAG       540
     AGCGGCGGCC CGGCCATCAC CGACGTGATG GCGGGGCAGG TGGACTTCAT GTTCGGCACC       600
     GTGGCCGCCA CCGCGCCGCA TATCGCGGCC GGCAAGCTGC GCGCGCTGGC CGTGTCCTCG       660
     CCCGAGCGTT CCAGGCGCCT GCCCGATGTG CCCACGGTGG CCGAGGCGGC CATCCCCGGC       720
     TACGAGGCCT ATGAGTGGAA CGGCATGTTC CTGCCCGCGG GCACGCCCGC GCCCATCGCC       780
     GCGCAGTTGC ACAAGGCGCT GGCCGAAGTG CTGCAGGAGG ACGAGGTGCG CCAGCGCCTG       840
     GCCGACATGG GCGCGCAGCC CATCGGCTCC ACGCCGGCCG AGTTCGCCGC CTTCCTCAAG       900
     AAGGAAGACG CGAAATGGGG CGAGGTGGTG CGCAAGGGCC ACATTAAGCT GGATTAA          957
//

If you have problems or comments...

PBIL Back to PBIL home page