(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE342

ALDEN1_2.PE342       Location/Qualifiers
FT   CDS_pept        379912..380787
FT                   /locus_tag="Alide_0352"
FT                   /gene_family="HOG000107488" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /codon_start="1"
FT                   /product="amidohydrolase 2"
FT                   /transl_table="11"
FT                   /note="PFAM: amidohydrolase 2; KEGG: dac:Daci_4273
FT                   amidohydrolase 2"
FT                   /db_xref="GI:319761080"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="GeneID:10102375"
FT                   /translation="MAQPLLSAPVPHSVGLNRPARTLPPLACDSHMHIFDPRFAPSPHW
FT                   RRQPPDAPVAAYRQLQQRLGTRRAVVVTPSTYGTGNACTLDALDQLGDDARGVAVVAQD
FT                   VQDAELDRLHARRVRGLRVNFVSPQSWGETTPQMLATLARKAARLPGWHIQVFMHPEQI
FT                   VALESVLAALPVPLVVDHLGRIDPAQGQRAEAHGALRRLLDGGNAWVKLSGAYMRSTAP
FT                   AYADTLPLAQALVRAAPERLVWGSDWPHTTEAPGTVNDAGLVDLLRAWAGSDAAMDRIL
FT                   VDNPARLYGF"
FT                   /protein_id="YP_004125017.1"
     GTGGCGCAGC CCCTGCTCTC CGCGCCCGTG CCGCACTCCG TGGGCCTGAA CCGGCCCGCG        60
     CGCACGCTGC CGCCGCTGGC CTGCGACAGC CACATGCACA TCTTCGACCC GCGCTTCGCC       120
     CCATCGCCGC ACTGGCGGCG CCAGCCGCCC GACGCGCCCG TGGCCGCCTA CCGGCAATTG       180
     CAGCAGCGCC TGGGCACGCG GCGCGCGGTG GTGGTCACGC CATCCACCTA CGGCACCGGC       240
     AACGCCTGCA CGCTGGATGC CCTCGATCAA CTGGGCGACG ATGCGCGCGG CGTGGCCGTG       300
     GTGGCGCAAG ACGTTCAGGA CGCCGAGCTC GACCGCCTGC ACGCGCGCCG CGTGCGCGGG       360
     CTGCGCGTGA ACTTCGTCTC GCCGCAATCC TGGGGCGAGA CCACGCCGCA GATGCTGGCC       420
     ACGCTGGCGC GCAAGGCGGC GCGCCTGCCG GGCTGGCACA TCCAGGTCTT CATGCATCCG       480
     GAGCAGATCG TGGCATTGGA GAGCGTGCTC GCAGCGCTGC CCGTGCCGCT GGTGGTGGAC       540
     CACCTGGGCC GCATCGATCC GGCCCAGGGG CAGCGTGCAG AAGCTCATGG CGCGTTGCGC       600
     CGGCTGCTGG ACGGCGGCAA TGCCTGGGTC AAGCTCTCGG GCGCCTACAT GCGCTCGACC       660
     GCGCCCGCGT ATGCGGATAC GCTGCCGCTC GCCCAGGCGC TGGTGCGCGC CGCGCCCGAG       720
     CGCCTGGTGT GGGGCAGCGA CTGGCCGCAC ACCACCGAGG CGCCGGGCAC CGTGAACGAT       780
     GCCGGCCTGG TGGACCTGCT GCGTGCCTGG GCCGGATCGG ACGCGGCGAT GGACCGCATC       840
     CTCGTGGACA ACCCGGCGCG CCTGTACGGC TTTTGA                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page