(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE343

ALDEN1_2.PE343       Location/Qualifiers
FT   CDS_pept        380800..381717
FT                   /locus_tag="Alide_0353"
FT                   /gene_family="HOG000219379" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /codon_start="1"
FT                   /product="smp-30/gluconolaconase/lre-like region-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE-like
FT                   region-containing protein; KEGG: dac:Daci_4272
FT                   SMP-30/gluconolaconase/LRE domain-containing protein"
FT                   /db_xref="GI:319761081"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="GeneID:10102376"
FT                   /translation="MFLLQAPEVRELELFTSMPEPLRRRQRSAWADANRGGAVTDSFLE
FT                   GPVFDDAGNLYVTDIPWGRILRIDAQGAWTLVAEYDGEPNGMKFLDAGTLLITDYKNGL
FT                   MRLDVASGKVTPYLERRNSERFKGVNDLVFDSAGNLYFTDQGQSGLHDPSGRLYRLRPS
FT                   GQLDLLLANVPSPNGVALSPDERVLYLAATRGNCVWRVPLLPDGSVAKVGQFFTSYGPS
FT                   GPDGLAVDAEGRVLVANPGLGYVWVLNGRAEPVLVLRGAPGSSTTNLAFGGEGRRQLYV
FT                   TDSTHGRILRAALDAPGLALHRPR"
FT                   /protein_id="YP_004125018.1"
     ATGTTTCTGC TGCAAGCCCC CGAAGTTCGC GAACTGGAGC TGTTCACCTC CATGCCCGAG        60
     CCGCTGCGCC GCCGCCAGCG CAGCGCCTGG GCCGACGCCA ACCGCGGCGG CGCGGTGACG       120
     GACTCGTTCC TCGAAGGCCC GGTGTTCGAC GACGCCGGCA ACCTCTACGT CACCGACATC       180
     CCCTGGGGCC GCATCCTGCG CATCGACGCG CAGGGCGCCT GGACCCTGGT GGCCGAGTAC       240
     GACGGCGAGC CCAACGGCAT GAAGTTCCTG GATGCCGGCA CGCTGCTCAT CACCGACTAC       300
     AAGAACGGCC TGATGCGCCT GGACGTGGCG AGCGGCAAGG TCACGCCTTA CCTGGAGCGG       360
     CGCAACAGCG AGCGCTTCAA GGGCGTGAAC GACCTGGTCT TCGACAGCGC CGGCAACCTG       420
     TACTTCACCG ACCAGGGGCA GAGCGGCCTG CACGACCCCA GCGGGCGCCT GTACCGCCTG       480
     CGGCCCAGCG GCCAGCTGGA CCTGCTGCTT GCCAACGTGC CCAGCCCCAA CGGCGTGGCG       540
     CTGTCGCCCG ACGAGCGCGT GCTGTACCTG GCCGCCACGC GCGGCAACTG CGTGTGGCGC       600
     GTGCCCCTGC TGCCCGACGG CAGCGTGGCC AAGGTGGGCC AGTTCTTCAC CTCCTACGGC       660
     CCCAGCGGCC CGGACGGCCT GGCGGTGGAC GCCGAGGGCC GCGTGCTCGT CGCCAACCCC       720
     GGCCTGGGCT ACGTCTGGGT GCTTAACGGC CGCGCCGAGC CGGTGCTGGT GCTGCGCGGC       780
     GCGCCGGGCA GCTCCACCAC CAACCTGGCT TTCGGCGGGG AGGGGCGGCG CCAGCTTTAC       840
     GTGACCGACT CCACGCACGG GCGCATCCTG CGCGCGGCGC TGGACGCGCC GGGGCTGGCG       900
     CTGCACCGGC CCCGCTGA                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page