(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE344

ALDEN1_2.PE344       Location/Qualifiers
FT   CDS_pept        complement(381729..382712)
FT                   /locus_tag="Alide_0354"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Rmet_4433"
FT                   /codon_start="1"
FT                   /product="extra-cytoplasmic solute receptor"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_4433 extra-cytoplasmic solute
FT                   receptor"
FT                   /db_xref="GI:319761082"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="GeneID:10102377"
FT                   /translation="MHPIITRRGALRYALAAACAPGLAFAQEAPFPSTNVHLVVPYAAG
FT                   GATDIVARAVADKLGPRWGKPVVIDNKPGAGTTLAAAQVARAPGDGHLLYMTTSAHTIS
FT                   AALYKKLDYDPLASFAALTLVAKVPLVLVVRPSLDVSTLDEFTRYVRANPDKAAYASPG
FT                   NGTAQHLTGEMFNAAMKTRMVHVPYKGDAPAITDLLGGSVDAMFATLTVVLPHIASGKL
FT                   KAIALANGSRIEKVPAIPTFAEAGLPNFEAATWFGVLAPASLPKGLRERISRDIRAVVD
FT                   QPDLRARLIDLGGEVVSNTPAAFEAFMQAESAKWQGIARQSGAVIN"
FT                   /protein_id="YP_004125019.1"
     atgcacccca tcatcacccg ccgcggcgca ctgcgctacg ccctggccgc cgcatgcgcg        60
     cccggcctgg ccttcgccca ggaagcgccg ttcccttcca ccaacgtcca cctcgtcgtg       120
     ccctacgcgg caggcggcgc caccgacatc gtggcccgcg cggtggccga caagctgggc       180
     ccgcgctggg gcaaaccggt cgtcatcgac aacaagcccg gcgccggtac gaccctggcc       240
     gccgcgcaag tcgcacgagc cccgggcgac ggccacctgc tctacatgac cacctcggcg       300
     cacaccatca gcgctgccct gtacaagaag ctcgactacg acccgctggc gagcttcgcc       360
     gcgctcacgc tggtcgccaa ggtgccgctg gtgctcgtcg tgcggcccag cctggacgtc       420
     tcgacgctcg acgagttcac ccgctacgtg cgcgccaacc cggacaaggc ggcctacgcc       480
     tcgcccggca acggcacggc ccagcacctc acgggcgaga tgttcaacgc cgcgatgaaa       540
     acgcgcatgg tgcacgtgcc ctacaagggc gacgcgccgg ccatcaccga cctgctgggc       600
     ggttcggtgg acgcgatgtt cgccacactc accgtggtgc tgccgcacat cgcctcgggc       660
     aagctcaagg ccattgcgct ggccaacggc agccgcatcg agaaggtgcc cgccattccc       720
     acgttcgccg aggcggggct cccgaacttc gaggccgcca cctggttcgg cgtgctcgcg       780
     cccgcatcgc tgcccaaggg cctgcgcgag cgcatcagcc gggacatccg cgcggtggtg       840
     gaccagcccg acctgcgcgc gcggctgatc gaccttggcg gcgaagtcgt ctccaacacg       900
     cccgcggcat tcgaggcctt catgcaggcc gagtcggcca agtggcaagg catcgcccgc       960
     cagtccggcg cggtgatcaa ttag                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page