(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE345

ALDEN1_2.PE345       Location/Qualifiers
FT   CDS_pept        complement(382731..383624)
FT                   /locus_tag="Alide_0355"
FT                   /gene_family="HOG000219610" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.1.1.31"
FT                   /codon_start="1"
FT                   /EC_number="1.1.1.31"
FT                   /transl_table="11"
FT                   /note="KEGG: vei:Veis_2089 6-phosphogluconate
FT                   dehydrogenase, NAD-binding; PFAM: 6-phosphogluconate
FT                   dehydrogenase NAD-binding"
FT                   /db_xref="GI:319761083"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="GeneID:10102378"
FT                   /translation="MSNTTSQVIGFIGLGVMGEPICRNLAVKTGARVIAHDLDAAPLQR
FT                   LAAHGVQAAPSAAAVMQAADVVFLSLPSGEVVAQLCRQDGGLLASARAGQTIVDLSTSP
FT                   VDTTRALAGEFAALGARFVDAPVARTRAAAEAGTLAVMVGAAPEVFEAVKPLIATFASD
FT                   IALCGPVGCGQVLKILNNMVLFETVVAVSEAKAIGEKAGVDPNVLFDTLSKGSADSFAL
FT                   RNHGMKAVLPGEFPERAFSVLYARKDLKYALQLARDAGVDARGAAVVDAWFQQAIDSGL
FT                   GEKYHPVISRLIAGQR"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /protein_id="YP_004125020.1"
     atgagcaaca ccaccagcca agtgatcggc ttcatcggac tgggcgtgat gggcgaaccc        60
     atctgccgca acctcgcggt gaagaccggc gcccgcgtga tcgcgcacga cctcgacgcc       120
     gccccgctgc agcgcctggc cgcgcacggc gtgcaggccg cgcccagcgc cgcggccgtg       180
     atgcaggcgg ccgacgtcgt cttcctctcc ctgccctcgg gcgaagtcgt cgcgcagctg       240
     tgccgccagg acggcggcct gctggcctcg gcccgcgcgg gccagaccat cgtggacctg       300
     agcacctcgc ccgtggacac cacgcgcgcg ctggccggcg aattcgcggc cctgggcgcg       360
     cggttcgtgg acgcgcccgt ggcgcgcacc cgcgccgccg ccgaggcggg cacgctcgcg       420
     gtgatggtgg gcgccgcgcc cgaggtgttc gaggccgtca agccgctgat cgccaccttc       480
     gcctccgaca tcgcgctgtg cggtcccgtg ggctgcggcc aggtgctcaa gatcctcaac       540
     aacatggtgc tattcgagac cgtggtggcc gtgagcgagg ccaaggccat cggcgagaag       600
     gccggagtcg atcccaacgt gctgttcgac acgctctcga agggctcggc cgacagcttc       660
     gcgctgcgca accacggcat gaaggccgtg ctgcccggtg agttccccga gcgcgcgttc       720
     tccgtgctct acgcgcgcaa ggatctgaag tacgcgctgc aactggcgcg cgacgcgggc       780
     gtggacgcgc gcggcgcggc cgtcgtcgat gcctggttcc agcaggccat cgacagcggc       840
     ctgggcgaga agtaccaccc cgtcatcagc cggctgatcg ccggccagcg ctga             894
//

If you have problems or comments...

PBIL Back to PBIL home page