(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE348

ALDEN1_2.PE348       Location/Qualifiers
FT   CDS_pept        386294..386698
FT                   /locus_tag="Alide_0358"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Tcur_0017"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tcu:Tcur_0017 hypothetical protein"
FT                   /db_xref="GI:319761086"
FT                   /db_xref="GeneID:10102381"
FT                   /translation="MSSHTTHTSLAERFASLAPHVNANACLVHRGRALTADLVIVVGTA
FT                   RFLLRIHQGEVVEVTQRFALFHPCALFVQGTAKAWERLWEKVPPPGWHDLFALHKRGEM
FT                   VIEGDTRLLFSHLQYLKDVLEMPRHVPADA"
FT                   /protein_id="YP_004125023.1"
     ATGAGCTCAC ACACCACGCA CACATCCCTG GCCGAGCGGT TCGCCTCGCT CGCGCCGCAC        60
     GTCAACGCGA ACGCCTGCCT CGTGCATCGG GGCAGGGCGT TGACGGCCGA CCTCGTCATC       120
     GTCGTCGGAA CGGCGCGGTT CCTGCTGCGT ATCCACCAGG GCGAAGTCGT CGAAGTCACG       180
     CAGCGGTTCG CGCTGTTCCA TCCGTGCGCG CTCTTTGTGC AGGGGACGGC CAAGGCCTGG       240
     GAGCGCCTCT GGGAAAAGGT GCCTCCTCCC GGCTGGCACG ACCTGTTCGC CTTGCACAAG       300
     CGGGGCGAGA TGGTGATCGA GGGGGACACC AGGCTGTTGT TCTCGCATCT GCAGTACCTC       360
     AAGGACGTGC TGGAAATGCC GCGCCACGTG CCTGCGGACG CTTGA                       405
//

If you have problems or comments...

PBIL Back to PBIL home page