(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE349

ALDEN1_2.PE349       Location/Qualifiers
FT   CDS_pept        386719..387567
FT                   /locus_tag="Alide_0359"
FT                   /gene_family="HOG000076805" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   msm:MSMEG_2534 carboxylesterase protein"
FT                   /db_xref="GI:319761087"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="GeneID:10102382"
FT                   /translation="MKDRIEPIVGRYIHVDVLGETCRIYFEECGQGIPLLCLHTAGSDG
FT                   RQFRHLLNDAGVTDRFRVIAFDMPWHGKSYPPVGFHERDYELTTERYVATIRAFSAALG
FT                   LDRPVVMGCSIGGRIVLQLAHAHGAEFRALIGLESADHQQPWYDTSWLNRPDVHGGEVC
FT                   AALVSGLIAPQSPSEYRHETLWQYKQSGPGIFKGDLYFYRVDSDLRGKLGGIDTSTTPL
FT                   YLLTGEYDFSCSPEDSIRTAETIPGAKVTVMKELGHFPMSENPAQFRKYILPVLDEIAA
FT                   R"
FT                   /protein_id="YP_004125024.1"
     ATGAAAGACC GCATTGAGCC CATCGTCGGC CGATACATCC ACGTGGATGT CCTGGGGGAG        60
     ACATGCCGCA TCTATTTCGA GGAATGCGGC CAGGGCATTC CCCTGCTGTG CCTGCACACG       120
     GCCGGCTCCG ATGGCCGCCA GTTCCGCCAC CTGCTCAACG ACGCCGGCGT CACGGACAGG       180
     TTTCGCGTTA TCGCCTTCGA CATGCCCTGG CACGGCAAGT CCTATCCCCC CGTCGGTTTC       240
     CACGAGCGGG ACTACGAGCT CACCACCGAG CGCTACGTGG CCACGATCCG CGCGTTCAGC       300
     GCCGCGCTGG GGCTGGACAG GCCGGTGGTC ATGGGCTGCT CCATCGGCGG GCGGATCGTG       360
     CTGCAGCTGG CGCATGCCCA CGGCGCCGAA TTCCGGGCGC TCATCGGCCT GGAGAGCGCC       420
     GACCACCAGC AGCCCTGGTA CGACACGAGC TGGCTGAACC GCCCAGACGT GCACGGCGGC       480
     GAGGTTTGCG CCGCGCTGGT GTCCGGCCTG ATCGCGCCGC AAAGCCCGAG CGAATACCGC       540
     CATGAAACCC TGTGGCAATA CAAGCAGAGC GGCCCTGGGA TCTTCAAGGG CGACCTGTAT       600
     TTCTACCGCG TGGATTCCGA CCTGCGCGGC AAGCTGGGCG GCATCGATAC GTCCACCACG       660
     CCGCTCTACC TGCTGACGGG CGAATACGAC TTCTCCTGCA GTCCCGAGGA CTCGATCCGT       720
     ACCGCCGAAA CCATTCCCGG CGCGAAGGTG ACCGTCATGA AGGAGCTGGG GCATTTCCCC       780
     ATGAGCGAGA ACCCCGCGCA ATTCAGGAAA TACATCCTGC CTGTGCTGGA CGAGATCGCG       840
     GCCCGCTGA                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page