(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE35

ALDEN1_2.PE35        Location/Qualifiers
FT   CDS_pept        complement(43852..44289)
FT                   /locus_tag="Alide_0035"
FT                   /gene_family="HOG000266076" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02044"
FT                   /codon_start="1"
FT                   /product="cu(i)-responsive transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Cu(I)-responsive transcriptional regulator;
FT                   PFAM: Transcription regulator MerR DNA binding; regulatory
FT                   protein MerR; KEGG: dia:Dtpsy_0035 transcriptional
FT                   regulator, MerR family; SMART: regulatory protein MerR"
FT                   /db_xref="GI:319760773"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0016563"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="GeneID:10102058"
FT                   /translation="MSRQIAAPAQDWPVPIGTAAERAGVSARMVRHYESLGLLTGVART
FT                   SNGYRQYTEADVHTLRFIRRARDLGFSMEEIAALLGLWQDKARASSQVKQIAQKHIASL
FT                   SERIAAMQAMQRSLQALVGCCHGDDRPDCPILDDLAGPGAH"
FT                   /protein_id="YP_004124710.1"
     gtgagccgtc agatcgccgc acccgcgcaa gactggcccg tgcccatagg cacggcggcc        60
     gagcgcgccg gcgtctcggc gcgcatggtg cggcactacg aatcgctagg cctgctcacc       120
     ggcgtggccc gcacaagcaa cggctaccgc cagtacaccg aggccgacgt gcacaccctg       180
     cgcttcatcc gccgcgcgcg cgacctgggc ttttccatgg aagagatcgc cgccctgctc       240
     ggcctgtggc aggacaaggc ccgcgccagc agccaggtca agcagatcgc gcaaaagcac       300
     atagcaagcc tgagcgaacg catcgccgcc atgcaggcca tgcagcgcag cctgcaggcg       360
     ctggtgggct gctgccatgg ggacgaccgg ccggactgcc ccatcctgga cgaccttgcc       420
     gggccgggcg cgcattag                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page