(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE350

ALDEN1_2.PE350       Location/Qualifiers
FT   CDS_pept        387622..388776
FT                   /locus_tag="Alide_0360"
FT                   /gene_family="HOG000128115" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /codon_start="1"
FT                   /product="extracellular ligand-binding receptor"
FT                   /transl_table="11"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bav:BAV0983 ABC transporter, substrate-binding protein"
FT                   /db_xref="GI:319761088"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="GeneID:10102383"
FT                   /translation="MKKILAASLLCVGCGAFAQEELKIGAIVTLSGAGAAWGQAMLYAA
FT                   ELAADDVNAKGGLDVGGRKYKVKVVAYDDKYQAGEAVTAANRLVFEDKVKYVIGPVGSA
FT                   AALAVGPIMEKNKVVMLTLGFTDKALAADKPFSFRPNLTTMETSQPQIDWIVKAKNIKK
FT                   VGALFPNDETGQQIAQDLEKAYAKAGAQMNAKEFFERERVDMMPLLTRIMAKGVDAIEL
FT                   DGNAPGTAGLIVKQARELGFKGHIIRSGGPATAEIVNVAGTGATNGMLVNTPINPANAE
FT                   VKAYAERYFGKYKKRMNGFSPAFYDGTRMLFQAMGQAGTATDTDKVRVALEGIKDFKGI
FT                   LGTLNWTGKEVYGSNHQISAPFYVARVQDGQEVVESTCSLSACK"
FT                   /protein_id="YP_004125025.1"
     ATGAAAAAGA TCCTTGCCGC CTCGCTGCTG TGCGTGGGCT GCGGCGCATT CGCCCAGGAA        60
     GAACTCAAGA TCGGCGCCAT CGTGACGCTG TCCGGCGCGG GCGCGGCTTG GGGCCAGGCC       120
     ATGCTGTATG CGGCCGAACT GGCCGCCGAT GACGTGAACG CCAAGGGCGG CCTCGACGTG       180
     GGCGGCAGGA AGTACAAGGT CAAGGTCGTC GCCTACGACG ACAAGTACCA GGCCGGCGAG       240
     GCCGTCACTG CCGCCAACCG CCTGGTCTTC GAGGACAAGG TCAAGTACGT GATCGGCCCC       300
     GTGGGATCGG CTGCGGCGCT GGCCGTGGGG CCCATCATGG AGAAGAACAA GGTCGTCATG       360
     CTGACCCTGG GCTTCACCGA CAAGGCGCTG GCGGCCGACA AACCGTTCAG CTTCCGCCCC       420
     AACCTGACGA CGATGGAAAC CTCGCAGCCC CAGATCGACT GGATCGTCAA GGCTAAGAAC       480
     ATCAAGAAAG TGGGCGCGCT CTTCCCCAAC GACGAGACCG GCCAGCAGAT CGCCCAGGAC       540
     CTGGAGAAGG CCTACGCCAA GGCCGGCGCG CAGATGAATG CCAAGGAATT CTTCGAGCGC       600
     GAGCGTGTGG ACATGATGCC CCTGCTCACC CGCATCATGG CCAAGGGTGT GGACGCCATC       660
     GAGCTCGACG GCAACGCGCC CGGCACAGCC GGCCTCATCG TCAAGCAGGC GCGCGAACTG       720
     GGTTTCAAGG GCCACATCAT CCGCAGCGGC GGCCCGGCCA CCGCCGAGAT CGTCAACGTG       780
     GCGGGCACGG GCGCGACCAA CGGCATGCTG GTCAACACGC CGATCAATCC GGCGAATGCG       840
     GAGGTCAAGG CCTATGCCGA GCGCTACTTC GGCAAGTACA AGAAGCGCAT GAACGGCTTC       900
     AGCCCGGCGT TCTACGACGG CACGCGCATG CTGTTCCAGG CCATGGGCCA GGCGGGCACC       960
     GCCACCGACA CGGACAAGGT GCGCGTGGCG CTCGAAGGCA TCAAGGACTT CAAGGGCATC      1020
     CTGGGCACCC TGAACTGGAC GGGCAAGGAG GTCTACGGCT CCAACCACCA GATCAGCGCG      1080
     CCGTTCTACG TCGCGCGCGT GCAGGACGGG CAGGAGGTGG TCGAAAGCAC CTGCTCCCTC      1140
     TCCGCCTGCA AGTAA                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page