(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE351

ALDEN1_2.PE351       Location/Qualifiers
FT   CDS_pept        388798..389667
FT                   /locus_tag="Alide_0361"
FT                   /gene_family="HOG000202530" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG: bav:BAV0982
FT                   ABC transporter, permease protein"
FT                   /db_xref="GI:319761089"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:10102384"
FT                   /translation="MDFTFLIGQALTNGLIIGLLYLLMAIGFTLVFGVMRVVNFAHGEF
FT                   YMLGAFLAYVCVTRLQLPFLAAVLATFAVTLVAGWIIEVLVLKGFRGNELNGMISTIGL
FT                   AMVLQNGALLVFGPDPQSMPPVAQGVVSLGPIVLPMSRLYVVAFSIAVLVLLYLFLMRS
FT                   KGGRALRAVVQDTEIASAQGIRSHLMYPLGFGIGVALAAVAGALMAPVFSVSPSIGSTP
FT                   LLKAFIVVILGGLGSIPGAALASLLLGVVESAANTFMSSSMSDMLLFGFVILMLIFRPS
FT                   GLLGKSGR"
FT                   /protein_id="YP_004125026.1"
     GTGGATTTCA CATTCCTCAT TGGTCAGGCA CTGACCAATG GCCTCATCAT CGGGTTGCTC        60
     TACCTGCTGA TGGCCATTGG CTTCACGCTG GTCTTCGGTG TCATGCGGGT GGTCAACTTC       120
     GCGCATGGCG AGTTCTACAT GCTGGGCGCC TTCCTCGCCT ACGTCTGTGT CACCCGGCTC       180
     CAGCTGCCTT TCCTAGCGGC GGTGCTCGCC ACCTTCGCCG TGACCCTGGT CGCGGGCTGG       240
     ATCATCGAAG TGCTGGTGCT CAAGGGCTTT CGCGGCAACG AGCTCAACGG GATGATCAGC       300
     ACGATCGGGC TGGCGATGGT CCTGCAGAAC GGCGCCCTGC TGGTCTTCGG GCCCGACCCC       360
     CAGTCCATGC CGCCCGTGGC GCAGGGCGTG GTGTCGCTCG GCCCCATCGT GCTGCCCATG       420
     TCGCGGCTGT ACGTGGTGGC CTTCTCCATC GCCGTGCTGG TGCTGCTCTA CCTGTTCCTC       480
     ATGCGCAGCA AGGGCGGGCG GGCGCTGCGC GCCGTGGTGC AGGACACCGA GATCGCCAGC       540
     GCCCAGGGCA TCCGCTCGCA CCTCATGTAT CCGCTGGGCT TCGGCATCGG CGTGGCGCTG       600
     GCGGCCGTCG CGGGCGCGCT GATGGCGCCG GTGTTCTCGG TCTCGCCGAG CATCGGCTCC       660
     ACGCCCCTGC TCAAGGCCTT CATCGTGGTG ATCCTCGGCG GGCTGGGGAG CATTCCCGGC       720
     GCCGCGCTCG CCAGCCTGCT GCTGGGCGTG GTGGAGAGCG CGGCCAACAC CTTCATGTCC       780
     AGCAGCATGT CGGACATGCT GCTCTTCGGC TTCGTGATCC TGATGCTGAT CTTCCGCCCC       840
     TCGGGCCTGC TCGGAAAGTC CGGACGCTGA                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page