(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE352

ALDEN1_2.PE352       Location/Qualifiers
FT   CDS_pept        389672..390670
FT                   /locus_tag="Alide_0362"
FT                   /gene_family="HOG000202417" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   dma:DMR_11370 ABC transporter permease protein"
FT                   /db_xref="GI:319761090"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:10102385"
FT                   /translation="MHASSSISTMKPRAPDSGAGAPQARWRLWLPGLLVLFALPLFTSS
FT                   PFHMHLAVLICLNIIFVNGLSLLSRTGQLSFCHAAFMGMGAYASVIATTQWHVPFLLSV
FT                   ALGVAVAAAVAFLLGAVILRLQGVYFVLVTFCFGELFRLFLLEGGSYTGGANGIANIPP
FT                   ASILGLAFDTKTSFYVLAAACAFASIALLIALFRTPQGTALDAVGDNQELAEASGIGIQ
FT                   RTQMFAFVLGSAMAGFAGALLAHYLGFVSPESFNQHISVAAIVMLVIGGRASVLGPILG
FT                   ALIMTPLPELFRSAIETQNILYGITLILVLKFLPGGLVGIAAKLRGKGGKA"
FT                   /protein_id="YP_004125027.1"
     ATGCACGCCT CTTCCTCCAT TTCGACCATG AAGCCTCGCG CACCCGATTC CGGCGCTGGA        60
     GCCCCCCAGG CGCGCTGGCG CCTCTGGCTG CCCGGCCTGC TGGTCCTGTT CGCACTGCCG       120
     CTGTTCACCA GCAGTCCGTT CCATATGCAC CTGGCGGTGC TGATCTGCCT GAACATCATC       180
     TTCGTCAACG GGCTCTCCTT GCTCAGCCGC ACCGGGCAGC TCTCGTTCTG CCATGCTGCG       240
     TTCATGGGCA TGGGCGCCTA TGCCTCGGTG ATCGCCACCA CCCAGTGGCA TGTGCCCTTC       300
     CTGCTGTCGG TGGCGCTCGG CGTGGCCGTC GCCGCTGCCG TGGCCTTCTT GCTCGGCGCT       360
     GTGATCCTGC GCCTGCAGGG CGTGTACTTC GTGCTGGTGA CCTTCTGCTT CGGCGAGCTG       420
     TTCCGGCTGT TTCTGCTGGA AGGCGGCAGC TACACCGGCG GGGCCAACGG CATCGCCAAC       480
     ATTCCGCCCG CGTCCATCCT CGGCCTTGCG TTCGACACCA AGACGTCGTT CTACGTGCTG       540
     GCGGCCGCCT GCGCCTTCGC TTCCATCGCG CTGCTGATCG CGCTGTTTCG AACGCCCCAG       600
     GGCACGGCGC TGGACGCGGT GGGCGATAAC CAGGAACTGG CCGAGGCCAG CGGCATCGGC       660
     ATCCAGCGCA CGCAGATGTT CGCGTTCGTG CTGGGGTCTG CCATGGCCGG CTTCGCGGGC       720
     GCGCTGCTCG CGCACTACCT GGGCTTCGTC TCGCCCGAGT CGTTCAACCA GCACATTTCC       780
     GTGGCGGCCA TCGTCATGCT GGTGATCGGC GGCCGCGCGT CGGTGCTGGG GCCCATCCTG       840
     GGCGCGCTCA TCATGACGCC GCTGCCCGAG CTGTTCCGCA GCGCGATCGA GACGCAGAAC       900
     ATCCTCTACG GCATCACGCT GATCCTGGTG CTCAAGTTCC TGCCCGGCGG CCTCGTGGGG       960
     ATCGCCGCGA AGCTCCGAGG GAAGGGGGGC AAGGCATGA                              999
//

If you have problems or comments...

PBIL Back to PBIL home page