(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE353

ALDEN1_2.PE353       Location/Qualifiers
FT   CDS_pept        390667..391446
FT                   /locus_tag="Alide_0363"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="abc transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pth:PTH_2348 ABC-type branched-chain amino
FT                   acid transport systems, ATPase component; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:319761091"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:10102386"
FT                   /translation="MTALLKVDGLSRYFGGLAAVKDLSFELNAGEIVGLIGPNGAGKST
FT                   AFNVISGSLAPSAGRIQFAGQSIEGMRPSQVVRHGLARTFQSATVYPAATVQENLYRGA
FT                   LARFDVPVWAQIAQTASYRSALRKVREEVDEVLEITGLAPYRDDVAGALAYGHQKRIGV
FT                   AIGLATRPRLLLLDEPAAGLNPEECAEFGCLLKTLRDRHEISLLFVEHHMALVMNTCEK
FT                   IIVLVQGQKIAQGTPDEVRNNPAVIEAYLGVDEDAHG"
FT                   /protein_id="YP_004125028.1"
     ATGACCGCAC TGCTCAAGGT GGATGGCCTG TCCCGCTATT TCGGCGGCCT AGCCGCCGTG        60
     AAGGATCTGA GTTTCGAGCT CAACGCGGGC GAGATCGTCG GCCTGATCGG CCCCAACGGC       120
     GCGGGCAAGA GCACGGCCTT CAACGTGATC AGCGGCTCGC TGGCGCCGTC GGCCGGCCGC       180
     ATCCAGTTCG CGGGCCAATC CATCGAGGGC ATGCGGCCTA GCCAGGTGGT GCGCCACGGG       240
     CTGGCGCGCA CCTTCCAGTC GGCCACGGTG TACCCCGCCG CCACCGTGCA GGAGAACCTC       300
     TACCGGGGCG CCCTGGCGCG TTTCGACGTG CCCGTGTGGG CGCAGATCGC GCAGACGGCC       360
     AGCTATCGCA GCGCGCTTCG CAAGGTGCGC GAGGAAGTGG ACGAGGTGCT GGAGATCACC       420
     GGCCTGGCGC CCTACCGCGA CGACGTGGCC GGCGCGTTGG CCTACGGTCA CCAGAAGCGC       480
     ATTGGCGTGG CCATCGGTCT GGCCACGCGG CCCCGGCTGC TGCTGCTCGA CGAGCCCGCC       540
     GCCGGCCTCA ACCCCGAGGA GTGCGCCGAG TTCGGCTGCC TGCTCAAGAC GCTGCGCGAC       600
     CGGCACGAAA TCTCGCTGCT CTTCGTGGAG CACCACATGG CGCTGGTGAT GAACACCTGC       660
     GAAAAGATCA TCGTGCTCGT GCAGGGACAG AAGATCGCGC AGGGCACGCC CGACGAGGTG       720
     CGCAACAACC CCGCGGTGAT CGAAGCCTAT CTGGGAGTGG ACGAAGATGC CCACGGTTGA       780
//

If you have problems or comments...

PBIL Back to PBIL home page