(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE354

ALDEN1_2.PE354       Location/Qualifiers
FT   CDS_pept        391433..392146
FT                   /locus_tag="Alide_0364"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="abc transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: oan:Oant_4420 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:319761092"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:10102387"
FT                   /translation="MPTVEVKDVVVHYGLVEALHGVSFTVPAGQIVALVGSNGAGKSTT
FT                   LKALMGLKKVSAGSIHMDGRRIDATGPAQRVSMGLALSPEGRRLFPRMTVWENLMVGAH
FT                   TVGSAAARNRSLEQVCALFPRVQERRSQLAGSLSGGEQQMVAIGRALMSHPQILMLDEP
FT                   SLGIAPKIVSEIAQAIVRLNRETGISVILVEQNARLALKMAHHAYVFEQGTVIRSGSGQ
FT                   ELLRDAFVQKAFLGV"
FT                   /protein_id="YP_004125029.1"
     ATGCCCACGG TTGAAGTCAA GGATGTGGTG GTCCACTACG GGCTGGTGGA GGCGCTGCAC        60
     GGCGTCAGCT TCACGGTGCC GGCCGGCCAG ATCGTGGCGC TCGTCGGCTC CAACGGCGCG       120
     GGCAAGAGCA CCACGCTGAA GGCGTTGATG GGCCTTAAGA AGGTCTCGGC CGGCAGCATC       180
     CACATGGACG GCCGGCGCAT CGACGCCACC GGCCCGGCCC AGCGGGTCTC GATGGGGCTG       240
     GCGCTCTCTC CCGAGGGGCG CCGGCTGTTC CCGCGCATGA CCGTCTGGGA GAACCTCATG       300
     GTCGGCGCGC ACACCGTCGG CTCGGCGGCG GCGCGCAACC GCTCGCTGGA GCAGGTCTGC       360
     GCGCTGTTCC CGCGCGTGCA GGAGCGCCGC AGCCAGCTTG CGGGCTCGCT TTCCGGCGGG       420
     GAGCAGCAGA TGGTGGCCAT CGGCCGCGCG CTGATGTCGC ATCCGCAGAT CCTGATGCTC       480
     GACGAGCCCT CGCTGGGCAT CGCGCCCAAG ATCGTGTCCG AGATCGCGCA GGCCATCGTG       540
     CGCCTGAACC GGGAGACGGG CATCTCGGTG ATCCTGGTGG AGCAGAACGC GCGGCTCGCG       600
     CTCAAGATGG CGCACCACGC CTACGTGTTC GAGCAGGGCA CGGTGATCCG CTCGGGCTCC       660
     GGCCAGGAAC TGCTGCGGGA CGCGTTCGTA CAGAAAGCCT TTCTCGGAGT CTGA             714
//

If you have problems or comments...

PBIL Back to PBIL home page