(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE355

ALDEN1_2.PE355       Location/Qualifiers
FT   CDS_pept        392149..393171
FT                   /locus_tag="Alide_0365"
FT                   /gene_family="HOG000217475" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /codon_start="1"
FT                   /product="amidohydrolase 2"
FT                   /transl_table="11"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bbr:BB2353
FT                   hypothetical protein"
FT                   /db_xref="GI:319761093"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="GeneID:10102388"
FT                   /translation="MENLPIVPRAEVRPQWLARHHEAPLEPELPIIDPHHHLSDSLWGG
FT                   YLQDDLLADLGAGHNIQSTVFIQVGFGYREDGPGHLRPVGETERVAAIAGRIPAEAGTQ
FT                   VCEGIVGFADLALGARVEETLAAHLQAAAGRFRGIRCHAAAHAQFQYGVMHAPPLHLYM
FT                   DPKFREGYATLARFGLTFDSWAYHTQLDELCDLARAFPDIPVVIDHIGVPLGVGPYVGQ
FT                   RDAVFAEWKRLLQKIAALPNVCIKLGGLGMSVFGFGFHLAGRPPTSEELAQAWSPYILT
FT                   CIEIFGPSRCMFESNFPVDKGTCSYPVLWNTFKRITAGMSEDEKRQLYRDTAARFYRLA
FT                   "
FT                   /protein_id="YP_004125030.1"
     ATGGAGAACC TGCCCATCGT CCCGCGCGCC GAAGTGCGCC CGCAGTGGCT GGCCCGGCAC        60
     CACGAGGCGC CGCTGGAGCC GGAACTGCCC ATCATCGACC CCCACCACCA CCTGTCCGAC       120
     AGCCTGTGGG GCGGCTACCT GCAGGACGAC CTGCTGGCGG ATCTGGGCGC TGGGCACAAC       180
     ATCCAGTCCA CGGTCTTCAT CCAGGTGGGC TTCGGCTACC GCGAGGATGG CCCCGGGCAC       240
     CTGCGCCCCG TGGGCGAGAC GGAGCGCGTC GCGGCCATCG CCGGGCGCAT CCCCGCCGAA       300
     GCGGGCACGC AGGTCTGCGA GGGCATCGTG GGCTTCGCGG ACCTCGCGCT GGGCGCGCGC       360
     GTTGAGGAGA CCCTGGCCGC GCACCTGCAG GCCGCCGCAG GGCGCTTCCG CGGCATCCGC       420
     TGCCACGCGG CCGCGCATGC GCAGTTCCAG TACGGCGTGA TGCACGCTCC GCCGCTGCAC       480
     CTCTACATGG ACCCGAAATT CCGCGAGGGC TACGCCACGC TCGCGCGCTT CGGGCTCACG       540
     TTCGATTCCT GGGCCTACCA CACCCAGCTC GACGAGCTCT GCGACCTGGC GCGCGCCTTC       600
     CCCGACATCC CGGTGGTGAT CGACCACATC GGCGTGCCCC TGGGCGTGGG CCCCTACGTG       660
     GGGCAGCGCG ATGCCGTCTT CGCCGAATGG AAGCGGCTGC TGCAAAAGAT CGCCGCGCTG       720
     CCCAACGTCT GCATCAAGCT CGGCGGCCTG GGCATGAGCG TGTTCGGCTT CGGGTTCCAC       780
     CTGGCCGGGC GGCCGCCGAC CTCCGAGGAA CTGGCGCAGG CCTGGAGCCC CTACATCCTC       840
     ACCTGCATCG AAATCTTCGG CCCGTCGCGC TGCATGTTCG AGAGCAACTT CCCCGTGGAC       900
     AAGGGCACGT GCAGCTACCC GGTGCTGTGG AACACCTTCA AGCGGATCAC TGCGGGCATG       960
     TCAGAGGACG AGAAGCGGCA GCTCTACCGC GACACCGCTG CGCGGTTCTA TCGCCTTGCC      1020
     TGA                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page