(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE357

ALDEN1_2.PE357       Location/Qualifiers
FT   CDS_pept        393971..395173
FT                   /locus_tag="Alide_0367"
FT                   /gene_family="HOG000131660" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: ajs:Ajs_0230 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="GI:319761095"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102390"
FT                   /translation="MDFSLSPELRALRDKTRRFIAEQVIPLESDPRQSHHGPDESLRRE
FT                   LVARARAAGLLTPHASREMGGLGLSHVEKAVVFEEAGYSRLGPTALNIHAPDEGNIHLM
FT                   EEVATPAQKERWLRPQVAGELRSCFAMTEPSPGAGADPSMLQATAVRDGGDYVINGRKW
FT                   FITGADGADYAIVMARMEDGSATMFLTDMDRPGIVLESNMDAMDACFTGGHGVLRFENL
FT                   RVPAADVLGEIGKGFRYAQVRLAPARLTHCMRWLGQARRAHDTALDYVRRRHAFGKPLV
FT                   EHEGVGFMVADNDMDLHTARLHIWHTAWLLDQGEKCNFESSRAKVVCSEAEWRVVDRSV
FT                   QMLGGQGVTGETPVMRIFTDMRAFRIYDGPSEVHRWSMARKLAHLSEKAEAELLREGGA
FT                   A"
FT                   /protein_id="YP_004125032.1"
     ATGGACTTCT CCCTTTCCCC CGAACTGCGC GCCCTGCGCG ACAAGACCCG GCGCTTCATC        60
     GCCGAGCAGG TGATCCCGCT GGAGAGCGAC CCGCGCCAGT CCCACCACGG CCCCGACGAG       120
     TCGCTGCGCC GCGAGCTGGT GGCGCGCGCC CGGGCCGCCG GCCTGCTCAC GCCGCACGCA       180
     TCGCGCGAGA TGGGCGGGCT GGGCCTGTCG CACGTCGAGA AGGCCGTGGT GTTCGAAGAG       240
     GCGGGCTACT CGCGCCTGGG GCCCACGGCG CTCAACATCC ACGCGCCCGA CGAGGGCAAC       300
     ATCCACCTGA TGGAGGAAGT GGCCACGCCC GCACAGAAGG AGCGCTGGCT GCGCCCGCAG       360
     GTGGCGGGCG AACTGCGCTC GTGCTTCGCG ATGACCGAGC CCTCGCCCGG CGCGGGGGCC       420
     GATCCGTCCA TGCTGCAGGC CACGGCCGTG CGCGACGGCG GCGACTACGT GATCAACGGC       480
     CGCAAGTGGT TCATCACCGG CGCCGACGGC GCCGACTACG CCATCGTCAT GGCGCGCATG       540
     GAGGACGGCT CGGCCACCAT GTTCCTGACC GACATGGACC GCCCGGGCAT CGTGCTGGAG       600
     AGCAACATGG ACGCCATGGA CGCCTGCTTC ACCGGCGGCC ACGGCGTGCT GCGCTTCGAG       660
     AATCTGCGCG TGCCCGCGGC CGACGTGCTG GGCGAGATCG GCAAGGGCTT TCGCTACGCC       720
     CAGGTACGCC TGGCGCCCGC GCGCCTCACG CACTGCATGC GCTGGCTGGG CCAGGCGCGC       780
     CGCGCGCACG ACACGGCACT GGACTACGTG CGCAGGCGCC ACGCCTTCGG CAAGCCGCTG       840
     GTGGAGCACG AGGGCGTGGG CTTCATGGTG GCCGACAACG ACATGGACCT GCACACCGCG       900
     CGCCTGCACA TCTGGCACAC GGCCTGGCTG CTGGACCAGG GCGAGAAGTG CAACTTCGAG       960
     TCGAGCCGCG CCAAGGTCGT GTGCTCCGAG GCCGAGTGGC GCGTGGTGGA CCGCAGCGTG      1020
     CAGATGCTCG GCGGCCAGGG CGTGACGGGC GAGACGCCGG TGATGCGCAT CTTCACCGAC      1080
     ATGCGGGCCT TCCGCATCTA CGACGGCCCG AGCGAGGTGC ACCGCTGGAG CATGGCGCGC      1140
     AAACTCGCCC ACCTGTCCGA GAAGGCCGAG GCCGAGCTGC TGCGCGAAGG GGGCGCGGCA      1200
     TGA                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page