(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE359

ALDEN1_2.PE359       Location/Qualifiers
FT   CDS_pept        395940..396980
FT                   /locus_tag="Alide_0369"
FT                   /gene_family="HOG000131666" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /codon_start="1"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   ajs:Ajs_0232 aminoglycoside phosphotransferase"
FT                   /db_xref="GI:319761097"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="GeneID:10102392"
FT                   /translation="MSGPANPLPVEALADYLRAQGLAGSAPLQVRVLAGGQSNPTYRVT
FT                   AGAGRDYVLRKKPPGTLIASAHAIDREYRVMKALADTGVPVPRMLHYCESGELLGTPFY
FT                   VMEYLAGRVLMDQSLPGMEPAERHAIYREMNRVIAALHAVDYRAVGLGDYGKEGNYVGR
FT                   QIARWSRQCRESTVPMNEAMHCLMDWLPEHLPSGDETTLVHGDYRLDNLVFHPTEPRVI
FT                   GVLDWELSTLGHPLADLAYQCMAWRIPPSLWRGIAGLDLPALGIPQEAEYIAWYGAATG
FT                   RDAAGHWDYYLAYNLFRMAAILHGIAQRAADGNAAAEDAVETGAKAGPLAELGWQAAQR
FT                   YTATRK"
FT                   /protein_id="YP_004125034.1"
     ATGAGCGGCC CCGCGAATCC CTTGCCGGTG GAGGCGCTCG CCGACTACCT GCGCGCCCAG        60
     GGCCTGGCGG GCAGCGCGCC GCTGCAGGTG CGCGTGCTCG CGGGCGGCCA GTCCAACCCC       120
     ACCTATCGCG TCACCGCCGG CGCAGGCCGC GACTACGTGC TGCGCAAGAA GCCGCCGGGC       180
     ACGCTCATCG CCTCCGCCCA CGCCATCGAC CGCGAATACC GGGTGATGAA GGCGCTGGCG       240
     GACACCGGCG TGCCCGTGCC GCGCATGCTG CACTACTGCG AGAGCGGCGA ATTGCTCGGC       300
     ACGCCGTTCT ACGTGATGGA GTACCTGGCG GGCCGTGTGC TCATGGACCA GTCGCTGCCC       360
     GGCATGGAGC CCGCCGAGCG CCACGCTATC TACCGCGAGA TGAACCGCGT GATCGCCGCG       420
     CTGCACGCCG TGGACTACCG AGCCGTGGGG TTGGGCGACT ACGGCAAGGA GGGCAACTAC       480
     GTGGGCCGGC AGATCGCGCG CTGGTCGCGC CAGTGCCGCG AGTCCACCGT GCCCATGAAT       540
     GAGGCCATGC ACTGCCTCAT GGACTGGTTG CCCGAGCACC TGCCCTCCGG CGACGAGACC       600
     ACGCTGGTGC ACGGCGACTA CCGGCTGGAC AACCTCGTCT TCCACCCCAC CGAGCCGCGC       660
     GTCATCGGCG TGCTGGACTG GGAGCTCTCG ACCCTGGGCC ACCCGCTGGC CGATCTGGCC       720
     TACCAGTGCA TGGCCTGGCG CATTCCGCCC AGCCTGTGGC GCGGCATAGC CGGGCTGGAC       780
     CTGCCTGCCC TGGGCATCCC GCAGGAGGCC GAATACATCG CCTGGTACGG CGCCGCCACC       840
     GGCCGCGACG CGGCGGGCCA CTGGGACTAC TACCTGGCCT ACAACCTGTT TCGCATGGCG       900
     GCCATCCTGC ACGGCATCGC CCAGCGCGCG GCGGACGGCA ACGCCGCCGC CGAGGATGCG       960
     GTGGAGACCG GCGCCAAGGC GGGGCCTCTG GCCGAACTGG GCTGGCAGGC CGCGCAGCGC      1020
     TACACAGCTA CGCGCAAGTG A                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page