(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE36

ALDEN1_2.PE36        Location/Qualifiers
FT   CDS_pept        complement(44286..44483)
FT                   /locus_tag="Alide_0036"
FT                   /gene_family="HOG000038877" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00403"
FT                   /codon_start="1"
FT                   /product="heavy metal transport/detoxification protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: dia:Dtpsy_0036 heavy metal transport/detoxification
FT                   protein"
FT                   /db_xref="GI:319760774"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="GeneID:10102059"
FT                   /translation="MQYTFQVQGMTCGHCERAVVHAVRQVDTDAIVKVDLATGQVAVES
FT                   DQPREVLAAAIQEEGYKVAA"
FT                   /protein_id="YP_004124711.1"
     atgcaataca cgttccaagt ccagggaatg acctgcggcc actgcgagcg cgccgtggtg        60
     cacgccgtgc gccaggtcga caccgatgcc atcgtcaagg tggacctggc cacgggccag       120
     gtcgcggtcg agagcgacca gccgcgcgag gtcctggccg ccgccatcca ggaagagggc       180
     tacaaggtcg ccgcgtga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page