(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE38

ALDEN1_2.PE38        Location/Qualifiers
FT   CDS_pept        47011..48660
FT                   /locus_tag="Alide_0038"
FT                   /gene_family="HOG000148074" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /codon_start="1"
FT                   /product="chemotaxis sensory transducer"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0020 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="GI:319760776"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="GeneID:10102061"
FT                   /translation="MTMYALMRWFSIRMRMIGAIGVVLTLLFMLGGAGMLGMFRLHGLS
FT                   QDFIAQPHAAVRLLGELRGEMGQIRQAEKDMIIHYERPEAVRAAHTQWLTALDRAKAVA
FT                   TRIDGLNLEQEQALARDIAKHLDTYREQFAHVARQLEEGGYDTATIANRMSTKAVAQFV
FT                   VAAEKLQALDKALGAEVDGAIARQGSIAGQTQWLFGLAVLITVAVVVPFTLLNMVSICR
FT                   PLEAARALAQSIAGGNLAQRIEVDGRDEVADLQRALLDMQGGLGALVSQVRDASGNIAT
FT                   ASQEIAMGNQDLSARTEQTASNAQEAVAALSQLTATVQQTASSSQVANQLVASASGTAT
FT                   RGGQVVQQAVSSMHEISASSRKIGDIIGLIDSIAFQTNILALNAAVEAARAGEQGRGFA
FT                   VVAGEVRNLAQRSAAAASEIKGLIQSSVQAVEGGVRHVEDAGKAMQEIVVSVQRVTDMI
FT                   GEIHSAATEQAAGIGEVNASVGEIDRMTQQNAALVEESAAAAESLREQAARLSQVVQQF
FT                   QLADGQQAAARAAAPARAALESDPALPRLGVA"
FT                   /protein_id="YP_004124713.1"
     ATGACTATGT ACGCGCTCAT GCGCTGGTTC TCGATTCGCA TGCGCATGAT TGGCGCCATC        60
     GGTGTGGTGC TCACCCTGCT GTTCATGCTG GGAGGCGCGG GCATGCTGGG CATGTTCCGC       120
     CTCCATGGAC TGAGCCAGGA TTTCATAGCC CAGCCCCATG CGGCGGTGCG CCTGCTGGGC       180
     GAGCTGCGCG GGGAGATGGG GCAGATACGC CAGGCCGAGA AGGACATGAT CATCCATTAC       240
     GAGCGGCCCG AGGCGGTGCG CGCGGCGCAC ACGCAGTGGC TGACGGCGCT GGACCGCGCT       300
     AAGGCCGTGG CGACCAGGAT CGACGGCCTG AATCTGGAGC AGGAACAGGC CCTGGCGCGG       360
     GACATCGCCA AGCATCTGGA CACTTACCGC GAGCAGTTCG CCCACGTGGC GCGCCAGCTG       420
     GAGGAGGGCG GCTACGACAC GGCCACGATC GCCAACCGCA TGAGCACCAA GGCCGTGGCG       480
     CAGTTCGTGG TCGCCGCCGA GAAGCTGCAG GCCCTGGACA AGGCCCTGGG TGCCGAGGTG       540
     GACGGCGCCA TTGCGCGCCA GGGCAGCATC GCCGGGCAGA CCCAGTGGCT GTTCGGCCTA       600
     GCGGTGCTGA TCACCGTGGC GGTGGTGGTG CCGTTCACGT TGCTCAACAT GGTGTCGATC       660
     TGCCGCCCGC TGGAGGCGGC GCGCGCGCTG GCGCAGTCCA TCGCCGGCGG CAACCTGGCG       720
     CAGCGCATCG AGGTCGACGG CCGCGACGAG GTGGCCGACT TGCAGCGCGC GCTGCTGGAC       780
     ATGCAGGGTG GCCTGGGCGC GCTGGTCTCG CAGGTGCGCG ACGCCAGCGG CAACATCGCC       840
     ACCGCCAGCC AGGAGATCGC CATGGGCAAC CAGGACCTGT CGGCGCGCAC CGAGCAGACG       900
     GCCAGCAACG CTCAGGAGGC CGTGGCCGCG CTGTCGCAGC TCACGGCCAC GGTGCAGCAG       960
     ACGGCCTCGT CCTCGCAGGT GGCCAACCAG CTCGTGGCCT CGGCATCGGG CACGGCCACG      1020
     CGCGGCGGCC AGGTGGTGCA GCAGGCGGTG AGCAGCATGC ACGAGATCTC GGCCTCCAGC      1080
     CGCAAGATCG GCGACATCAT CGGCCTGATC GACTCCATCG CGTTCCAGAC CAACATCCTG      1140
     GCGCTCAACG CGGCGGTGGA GGCCGCGCGC GCGGGCGAGC AGGGCAGGGG CTTCGCCGTG      1200
     GTGGCCGGCG AGGTGCGCAA CCTCGCGCAG CGCAGCGCAG CGGCGGCCAG CGAGATCAAG      1260
     GGCCTGATCC AGTCGAGCGT GCAGGCCGTG GAAGGCGGCG TGCGCCACGT GGAGGACGCG      1320
     GGCAAGGCCA TGCAGGAGAT CGTGGTCAGC GTGCAGCGCG TGACGGACAT GATCGGCGAG      1380
     ATCCATTCCG CCGCCACCGA GCAGGCCGCG GGCATCGGCG AGGTCAATGC CTCCGTGGGC      1440
     GAGATCGACC GCATGACGCA GCAGAACGCG GCGCTGGTGG AAGAGTCCGC CGCGGCCGCC      1500
     GAGTCGCTGC GTGAGCAGGC CGCGCGCCTG TCGCAGGTGG TGCAGCAGTT CCAGCTGGCG      1560
     GATGGCCAGC AGGCGGCGGC GCGCGCCGCC GCCCCGGCAC GGGCCGCCCT GGAGTCCGAC      1620
     CCGGCCCTGC CGCGCCTGGG CGTGGCCTGA                                       1650
//

If you have problems or comments...

PBIL Back to PBIL home page