(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE39

ALDEN1_2.PE39        Location/Qualifiers
FT   CDS_pept        complement(48816..51911)
FT                   /locus_tag="Alide_0039"
FT                   /gene_family="HOG000126203" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00914"
FT                   /codon_start="1"
FT                   /product="heavy metal efflux pump, czca family"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_0038 CzcA family heavy metal efflux
FT                   protein; TIGRFAM: heavy metal efflux pump, CzcA family;
FT                   PFAM: acriflavin resistance protein"
FT                   /db_xref="GI:319760777"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="GeneID:10102062"
FT                   /translation="MKRLIHYALHQPLFVVLGTLLFAMAGVIAFKNLSVEAFPDVTDTQ
FT                   VTIIALYPGRAAEEVEKQVTLPIEVALSGLPNAIRVFSHTQFGLSFTVVTYDDNASVHI
FT                   VRQQVGERLRSVDLPPGVEAEIAPNATPVGEIMRYRLRGDGYSTTELRSTEDWVVERAL
FT                   RQVPGVADVVAMGGSIKQYEVQPDLDKLRAYKLTFQNLLDALGRGNANAGGSYVAQGTQ
FT                   QYAIRGIGLLQSSEDIGRIVVAAHGGTPVLIRDVAQVRVGAVPRLGTVGQDDDDDVVTG
FT                   IVVMRKGENPSVVLKDVKAKIADLNARSLPPGMQIVPFYDRTWLMEKTLTTVFRNLVEG
FT                   ALLVSLVLYIFLSNLRASLAVVVVIPLSLLATFMGLKFMGVPANLLSLGAMDFGIIVDG
FT                   AVIVIENIMHRLAERGEDMDDRDRRETIIEAASEVGRPTLFSMLIIIAAHIPIFALQRH
FT                   EGRIFQPMALSVTTALVGSLIFSLTLVPLLAYWMLRRKLPHGDNRVVVSAKRLYGPVLD
FT                   WALARRRTVVVISLAMFAVALAAASRLGSEFLPELDEGTIWVNVRLPASVSNDEAARML
FT                   RQVRQALRTVPEVRTTISKAGQPEDGTDPKTISMAEVFVDVKPADQWRAGLTHKQLIEE
FT                   MDRAVSAIPGLEPAFSQPIRDNVLESISQIDGQIVIKVSGDDLGELKRITQGIEREIKQ
FT                   VPGVYRAEIDRLGDLPQLVIDIDRDRAARYGLNVGDIQDVIEAALAGKATTSLWEGERK
FT                   FAVAVRLPEDRRAIASLPGTPIATPDGGYTTLGAVASIRETTGAMNIARENGSRTMAIG
FT                   IFIKDRDMGSVVKDMQERVRARIQLPPSYRVTWSGEFENQERAMKRLSVVVPISLLLIF
FT                   VLLFDAFKSFKTASLILVNVPLALIGGFIALWVLDIPLSVSAAIGFIALSGQAVLNGVV
FT                   MLSVYQQLQAGGMGVLEAVRQGSMQRLRTVLMTALLAMLGLLPMALSHEIGAETQRPLA
FT                   IVVIGGLVTATLLTLVVLPALYVAWFAPRRNGPAPEAPVAIA"
FT                   /protein_id="YP_004124714.1"
     atgaagcggc tgatccacta tgcgctgcac cagccgctct tcgtcgtgct gggtacgctg        60
     ctgttcgcca tggcgggcgt catcgcgttc aagaacctgt ccgtggaagc ctttcccgac       120
     gtgacggaca cgcaggtgac catcatcgcg ctctaccccg ggcgcgccgc cgaggaggtg       180
     gaaaagcagg tcacgctgcc gatcgaggtt gccctctcgg gcctgcccaa tgccatccgc       240
     gtgttctcgc acacgcagtt cggcctgtcg ttcaccgtgg tcacctacga cgacaacgcc       300
     agcgtgcaca tcgtgcgcca gcaggtgggc gagcgcctgc gcagcgtgga cctgccgccg       360
     ggcgtcgagg ccgagatcgc ccccaacgcc acgccagtgg gcgagatcat gcgctaccgc       420
     ctccggggcg acggctactc caccaccgag ctgcgcagca ccgaggactg ggtggtcgag       480
     cgcgcgctgc gccaggtgcc cggcgtggcc gacgtggtgg ccatgggcgg ctccatcaag       540
     caatacgaag tgcagcccga cctggacaag ctgcgcgcct acaagctcac gttccagaac       600
     ctgctcgacg cgctcgggcg cggcaacgcc aacgcgggcg gcagctacgt cgcccaggga       660
     acccagcagt acgccatccg cggcatcggc ctgctgcagt cgagcgagga catcggccgc       720
     atcgtcgtcg ccgcgcacgg cggcacgccg gtgctgatcc gcgacgtggc ccaggtcagg       780
     gtgggcgccg tgccgcgcct gggcaccgtg ggccaggacg acgacgacga cgtggtcacc       840
     ggcatcgtgg tgatgcgcaa gggcgagaac cccagcgtcg tgctcaagga cgtgaaggcc       900
     aagatcgccg acctgaacgc gcgcagcctg ccgccgggca tgcagatcgt gccgttctac       960
     gaccgcacct ggctcatgga gaaaacgctg accacggtgt tccgcaacct cgtggagggc      1020
     gcgctgctcg tctcgctcgt gctctacatc ttcctgtcga acctgcgcgc gagcctggcc      1080
     gtggtggtgg tgatcccgct gtcgctgctg gccaccttca tgggcctgaa gttcatgggc      1140
     gtgccggcca acctgctgtc gctgggcgcg atggatttcg gcatcatcgt ggacggcgcg      1200
     gtgatcgtga tcgagaacat catgcaccgc ctggccgaac gcggcgagga catggacgac      1260
     cgcgaccgac gcgagaccat catcgaggcc gcgagcgagg tgggccgccc cacgctgttc      1320
     tcgatgctca tcatcatcgc ggcgcacatc cccatcttcg cgctgcagcg ccacgagggc      1380
     cgcatcttcc agcccatggc gctgtcggtg accacggcgc tcgtcggctc gctgatcttc      1440
     tcgctcacgc tggtgccgct gctggcctac tggatgctgc gcaggaagct gccgcacggc      1500
     gacaaccgcg tggtcgtctc ggccaagcgc ctgtacggcc cggtgctcga ctgggcgctc      1560
     gcgcgccgcc gcacggtggt ggtgatatcg ctcgccatgt tcgccgtcgc gctggccgcg      1620
     gcatcgcgcc tggggtcgga gttcctgccg gaactcgacg aaggcacgat ctgggtgaac      1680
     gtgcgcctgc ccgccagcgt gtccaacgac gaggccgcgc gcatgctgcg ccaggtgcgc      1740
     caggccctgc gcaccgtgcc cgaggtgcgc accaccatct ccaaggcggg ccagcccgag      1800
     gacggcaccg accccaagac catcagcatg gccgaggtgt tcgtggacgt gaagcccgcg      1860
     gaccagtggc gcgccggcct cacgcacaag cagctcatcg aggagatgga ccgcgcggtc      1920
     tccgcgatcc ccggccttga gcccgcgttc tcccagccca tccgcgacaa cgtgctcgaa      1980
     tcgatctcgc agatcgacgg gcagatcgtc atcaaggtct cgggcgacga cctgggcgag      2040
     ctcaagcgca tcacgcaggg catagagcgc gagatcaagc aggtgcccgg cgtctaccgc      2100
     gcggagatcg accgtctggg cgacctgccc cagctcgtga tcgacatcga ccgcgaccgc      2160
     gcggcgcgct acggcctcaa cgtgggcgac atccaggacg tgatcgaggc ggccctggcc      2220
     ggcaaggcca ccaccagcct gtgggagggc gagcgcaagt tcgccgtcgc ggtgcgcctg      2280
     cccgaagacc ggcgcgccat cgccagcctg ccgggcacgc ccatcgccac gccggacggc      2340
     ggctacacca cgctcggcgc cgtcgccagc atccgcgaga ccacgggcgc gatgaacatc      2400
     gcgcgcgaga acggcagccg caccatggcc atcggcatct tcatcaagga ccgcgacatg      2460
     ggctcggtgg tcaaggacat gcaggagcgt gtgcgggccc gcatccagct accaccgagc      2520
     taccgcgtga cctggtcggg cgagttcgag aaccaggagc gcgccatgaa gcgcctgtcg      2580
     gtcgtggtcc ccatctcgct gctgctgatc ttcgtgctgc tgttcgacgc gttcaagtcg      2640
     ttcaagaccg cctcgctgat cctcgtgaac gtgccgctcg cgctcatcgg cggcttcatc      2700
     gcgctgtggg tgctggacat tccgctgtcg gtgtcggcgg ccatcggctt catcgcgctg      2760
     tcgggccagg ccgtgctcaa cggcgtggtc atgctctcgg tttaccagca gctgcaggct      2820
     ggcggcatgg gcgtgctcga ggccgtgcgc cagggctcca tgcagcgcct gcgcaccgtg      2880
     ctcatgacgg cgctgctggc catgctgggc ctgctgccca tggcgctgtc gcacgagatc      2940
     ggcgccgaga cgcagcgccc cctggccatc gtggtcatcg gcggcctggt cacggccacg      3000
     ctgctgacgc tggtggtgct gccggccctg tacgtggcct ggttcgcgcc gcgcaggaac      3060
     ggccccgcac ccgaggcgcc cgtggccatc gcctga                                3096
//

If you have problems or comments...

PBIL Back to PBIL home page