(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE42

ALDEN1_2.PE42        Location/Qualifiers
FT   CDS_pept        54567..55292
FT                   /locus_tag="Alide_0042"
FT                   /gene_family="HOG000034815" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="response regulator receiver"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_0041 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="GI:319760780"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="GeneID:10102065"
FT                   /translation="MRILIVEDDSVLRGVMQRSLADAGHRVDVAASVAEAHHFWCVQPF
FT                   DAVLLDLNLPLDGVDEGAGGAQLGSGLAVLRAARARGDRTPVLVLTARDRTHERIAGLD
FT                   AGADDYLGKPYDLAEVEARLRALVRRSRGTQDRTVAGALVLDRHVRRFTLHGLPLELPA
FT                   REFEVLWELMTPPGRVVNKRTLSEKLSDFDETLGDNALEAFISRLRKKLAGSGAGIRTL
FT                   RGLGYMLEAQAAPPADGMP"
FT                   /protein_id="YP_004124717.1"
     ATGCGAATCC TGATCGTCGA GGACGACTCC GTGCTGCGCG GCGTCATGCA GCGCAGCCTT        60
     GCCGATGCGG GCCACCGCGT GGACGTCGCC GCCAGCGTTG CCGAGGCCCA CCATTTCTGG       120
     TGCGTGCAGC CGTTCGACGC CGTGCTGCTG GACCTGAACC TGCCGCTGGA CGGGGTCGAC       180
     GAAGGCGCCG GCGGCGCGCA GCTCGGCAGC GGCCTGGCGG TGCTGCGCGC GGCGCGCGCG       240
     CGCGGCGACC GCACGCCCGT GCTGGTGCTC ACGGCGCGCG ACCGCACGCA CGAGCGCATC       300
     GCGGGGCTGG ACGCCGGGGC CGACGACTAC CTGGGCAAGC CCTACGACCT GGCCGAGGTC       360
     GAGGCGCGGC TGCGCGCCCT GGTGCGCCGC AGCCGGGGCA CGCAGGACCG TACCGTGGCC       420
     GGCGCCCTGG TGCTGGACCG GCATGTGCGC CGTTTCACGC TGCACGGCCT GCCACTGGAG       480
     CTGCCCGCGC GCGAGTTCGA GGTGCTGTGG GAGCTCATGA CCCCGCCGGG CCGCGTGGTG       540
     AACAAGCGCA CCCTGTCGGA AAAGCTTTCC GACTTCGACG AGACCCTGGG CGACAACGCG       600
     CTGGAGGCCT TCATCTCGCG CCTGCGCAAG AAGCTGGCGG GCAGCGGCGC GGGCATTCGC       660
     ACGCTGCGCG GCCTGGGCTA CATGCTGGAG GCGCAGGCCG CGCCGCCCGC CGACGGCATG       720
     CCATGA                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page