(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE45

ALDEN1_2.PE45        Location/Qualifiers
FT   CDS_pept        complement(57920..58528)
FT                   /locus_tag="Alide_0045"
FT                   /gene_family="HOG000125748" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /codon_start="1"
FT                   /product="glutathione s-transferase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   dia:Dtpsy_0042 glutathione S-transferase domain protein"
FT                   /db_xref="GI:319760783"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="GeneID:10102068"
FT                   /translation="MKLYYSPGACSLSPHIVLHEAGLAYEPVLASTKTHKLADGTDFYS
FT                   INPLGYVPVLELDDGTRLREGPAIVQYLADQAPQKNLAPAPGTLARYRLQEWLSFIGTE
FT                   VHKGFGPLFAPGTPEEYKPQLKQRLLSRLQWVDGELAGKQYLMGDHFTVADAYLFTVTN
FT                   WAQFVGLDISQLKNLAAYRERIGARPAVQAAMKAEGLLK"
FT                   /protein_id="YP_004124720.1"
     atgaagctgt actactcccc tggcgcctgc tcgctctcgc cccacatcgt gctgcacgaa        60
     gccggcctag cctacgagcc cgtgctggcc agcaccaaga cgcacaagct ggccgacggc       120
     accgacttct acagcatcaa ccccctgggc tacgtgccgg tgctggagct ggacgacggc       180
     acgcgcctgc gcgagggccc ggccatcgtg cagtacctgg ccgaccaggc gccgcagaag       240
     aacctggccc ctgcccccgg cacactggcg cgttaccgcc tgcaggaatg gctgtccttc       300
     atcggcaccg aggtgcacaa gggcttcggg ccgctgttcg cacccggcac gccggaggag       360
     tacaagcccc agctcaagca gcgcctgctg tcccggctgc agtgggtcga cggcgaactc       420
     gcgggcaagc agtacctgat gggcgatcac ttcaccgtgg ccgacgccta cctgttcacc       480
     gtgaccaact gggcgcaatt cgtcggcctg gacatctcgc aactgaagaa cctggccgcc       540
     taccgcgaac gcatcggcgc ccgccccgca gtacaggccg ccatgaaggc ggagggtctg       600
     ctcaagtaa                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page