(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE47

ALDEN1_2.PE47        Location/Qualifiers
FT   CDS_pept        complement(58864..59442)
FT                   /locus_tag="Alide_0047"
FT                   /gene_family="HOG000263119" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /codon_start="1"
FT                   /product="nadph-dependent fmn reductase"
FT                   /transl_table="11"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   dia:Dtpsy_0044 NADPH-dependent FMN reductase"
FT                   /db_xref="GI:319760785"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="GeneID:10102070"
FT                   /translation="MKLLVFAGSTRQQSFNRRLARIAARMGRDAGAEVTLLELSDLDIP
FT                   MYNADLEARGTPPDVIRLKEILDAHPAWIICSPEYNGSYTGLLKNTIDWASSPVAGHPV
FT                   WTDVTRPFAGKVVGVLSASNGALGGLRSQSHLAPLLVNLGCWLAPRNYALARAASAFDA
FT                   GDDLADEAQRQQVRAVVDQVLWAAQRLCA"
FT                   /protein_id="YP_004124722.1"
     atgaaactcc tcgtcttcgc gggcagcacc cgccaacaat cgttcaaccg gcgcctggcc        60
     cgcatcgccg cccgcatggg ccgcgacgcc ggcgccgagg tcacgctgct ggagctgtcg       120
     gacctggaca tcccgatgta caacgctgac ctggaggcgc gcggcacgcc gcccgacgtg       180
     atccggctca aggaaatcct ggatgcccac cccgcctgga tcatctgctc gcccgaatac       240
     aacggcagct acaccggcct gctcaagaac accatcgatt gggcctccag ccccgtcgcc       300
     gggcatccgg tctggaccga cgtgacgcgc cccttcgccg gcaaggtggt gggcgtgctc       360
     agcgcgtcca acggcgcgct gggcggcctg cgctcgcaga gccatctggc gccgctgctc       420
     gtcaacctgg gctgctggct ggcgccgcgc aactacgccc tggcacgtgc cgccagcgcc       480
     ttcgatgccg gcgacgacct ggccgacgag gcgcagcgcc agcaagtgcg cgccgtggtc       540
     gatcaggtgc tgtgggctgc gcagcgcctc tgcgcctga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page