(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE48

ALDEN1_2.PE48        Location/Qualifiers
FT   CDS_pept        59574..61553
FT                   /locus_tag="Alide_0048"
FT                   /gene_family="HOG000201060" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00136"
FT                   /codon_start="1"
FT                   /product="glucose inhibited division protein a"
FT                   /transl_table="11"
FT                   /note="manually curated; TIGRFAM: glucose inhibited
FT                   division protein A; KEGG: dia:Dtpsy_0045 tRNA uridine
FT                   5-carboxymethylaminomethyl modification enzyme GidA; PFAM:
FT                   glucose-inhibited division protein A"
FT                   /db_xref="GI:319760786"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="GeneID:10102071"
FT                   /translation="MLYPQEFDVIVVGGGHAGTEAALAAARMGCRTLLLTHNIETLGQM
FT                   SCNPSIGGIGKGHLVKEVDALGGAMALATDEGGIQFRILNSSKGPAVRATRAQADRILY
FT                   KAAIRRMLENQPNLWLFQQAVDDLMVEGDRVAGAVTQIGLRFRARAVVLTAGTFLDGRI
FT                   HVGLNNYAAGRAGDPPAVSLSARLKELKLPQGRLKTGTPPRIDGRSIDFSQCEEQPGDG
FT                   MPGGVNEGVLPVFSFMGSTVMHPRQVPCWITHTNARTHEIIRSGFDRSPMFTGKIEGVG
FT                   PRYCPSVEDKINRFADKESHQIFLEPEGLTTHEFYPNGISTSLPFDIQYALVRSMRGLE
FT                   NAHILRPGYAIEYDYFDPRSLKSSFETRQIQGLFFAGQINGTTGYEEAAAQGLFAGLNA
FT                   ALQCRGEAPWLPRRDEAYLGVLVDDLVTKGVTEPYRMFTSRAEFRLQLREDNADMRLTE
FT                   AGRRMGLVDDARWDAFAAKRDAVSRETERLKSTWVNPRILAAAEAERVLGKAIDHEYNL
FT                   FDLLRRPDVDYARLMSLDGGKYASGDVSRETLGALSEPVIEQVEIAAKYAGYIDRQKDE
FT                   VQRAAHYEQLRLPPELDYMQVSALSIEVRQKLQKHRPETLGQASRISGVTPAAISLLLV
FT                   HLKKGGFKGFAQPAPTGEGHVVSA"
FT                   /protein_id="YP_004124723.1"
     ATGCTCTACC CCCAGGAATT TGATGTCATC GTCGTCGGCG GCGGCCATGC CGGTACTGAG        60
     GCCGCGCTGG CTGCGGCGCG CATGGGCTGC CGGACCTTGC TACTGACCCA CAACATAGAG       120
     ACCCTGGGGC AGATGAGCTG CAACCCCAGC ATCGGCGGCA TCGGCAAGGG CCACCTCGTG       180
     AAGGAGGTGG ATGCGCTGGG CGGCGCCATG GCGCTGGCGA CCGACGAGGG CGGCATCCAG       240
     TTCCGCATCC TCAACAGCAG CAAGGGTCCG GCCGTGCGCG CCACCAGGGC GCAGGCCGAC       300
     CGCATCCTCT ACAAGGCCGC CATCCGCCGC ATGCTGGAGA ACCAGCCCAA TCTGTGGCTG       360
     TTCCAGCAGG CCGTGGACGA CCTGATGGTG GAGGGCGACC GCGTGGCAGG CGCCGTCACC       420
     CAGATCGGTC TGCGCTTTCG CGCGCGCGCC GTGGTGCTCA CGGCCGGCAC CTTCCTGGAC       480
     GGCAGGATCC ATGTGGGCCT GAACAACTAC GCGGCCGGCC GCGCGGGCGA TCCGCCGGCC       540
     GTGAGCCTGT CGGCCCGGCT CAAGGAGCTG AAGCTGCCGC AGGGGCGCCT GAAGACCGGC       600
     ACGCCGCCGC GCATCGACGG GCGCAGCATC GACTTCTCGC AGTGCGAGGA GCAGCCCGGC       660
     GACGGCATGC CCGGCGGCGT GAACGAGGGT GTGCTGCCCG TGTTCAGCTT CATGGGAAGC       720
     ACGGTGATGC ACCCGCGCCA GGTGCCGTGC TGGATCACGC ACACCAACGC GCGCACGCAC       780
     GAGATCATCC GCAGCGGCTT CGACCGCAGC CCCATGTTCA CGGGCAAGAT CGAGGGCGTG       840
     GGCCCGCGCT ACTGCCCCAG CGTGGAGGAT AAGATCAATC GCTTCGCCGA CAAGGAAAGC       900
     CACCAGATCT TCCTGGAACC CGAGGGCTTG ACCACGCACG AGTTCTACCC CAACGGCATC       960
     TCCACCAGCC TGCCGTTCGA CATTCAGTAC GCGCTGGTGC GCTCCATGCG CGGCCTGGAG      1020
     AACGCCCACA TCCTGCGTCC CGGCTACGCC ATCGAGTACG ACTACTTCGA CCCGCGTTCG      1080
     CTCAAGAGCA GCTTCGAGAC GCGGCAGATC CAGGGGCTCT TCTTCGCCGG GCAGATCAAC      1140
     GGCACCACGG GCTACGAGGA GGCCGCCGCC CAGGGCCTGT TCGCTGGCCT GAACGCGGCC      1200
     CTGCAGTGCC GGGGCGAGGC GCCCTGGCTG CCGCGCAGGG ACGAGGCCTA CCTGGGCGTG      1260
     TTGGTGGACG ACTTGGTGAC CAAGGGCGTG ACTGAGCCTT ATCGCATGTT CACCAGCCGC      1320
     GCCGAGTTCC GCCTGCAGCT GCGCGAGGAC AACGCCGACA TGCGCCTGAC CGAGGCGGGG      1380
     CGCCGCATGG GGCTGGTCGA TGACGCGCGC TGGGACGCCT TCGCGGCCAA GCGCGACGCG      1440
     GTTTCACGTG AAACAGAGCG TCTCAAGAGC ACCTGGGTGA ACCCGCGCAT CCTTGCTGCG      1500
     GCCGAGGCCG AGCGCGTGCT GGGCAAGGCC ATCGACCACG AATACAACCT GTTCGACCTG      1560
     CTGCGTCGCC CGGACGTGGA CTATGCACGC CTCATGAGCC TGGATGGCGG CAAGTACGCC      1620
     AGCGGCGATG TTTCACGTGA AACCCTGGGC GCCTTGAGCG AGCCGGTGAT CGAGCAGGTG      1680
     GAGATCGCGG CCAAGTACGC GGGCTATATC GACCGCCAGA AGGACGAGGT GCAGCGCGCC      1740
     GCGCACTACG AGCAGTTGCG CCTGCCGCCC GAGCTGGACT ACATGCAGGT GTCGGCCCTG      1800
     TCCATCGAGG TGCGGCAGAA GCTGCAGAAG CACCGGCCCG AGACCCTGGG CCAGGCCTCG      1860
     CGCATCTCGG GTGTGACGCC GGCGGCCATC TCGCTGCTGC TCGTGCACCT GAAGAAGGGC      1920
     GGGTTCAAGG GCTTCGCGCA GCCGGCGCCC ACGGGGGAGG GCCATGTCGT TTCCGCTTGA      1980
//

If you have problems or comments...

PBIL Back to PBIL home page