(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE50

ALDEN1_2.PE50        Location/Qualifiers
FT   CDS_pept        61769..62416
FT                   /locus_tag="Alide_0050"
FT                   /gene_family="HOG000221012" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00138"
FT                   /codon_start="1"
FT                   /product="methyltransferase gidb"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0046 16S rRNA methyltransferase
FT                   GidB; TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein"
FT                   /db_xref="GI:319760788"
FT                   /db_xref="GO:0008649"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="GeneID:10102073"
FT                   /translation="MVDAAPLRQGVQALGLDLTEEQIARLLDFLALLQKWNKVYNLTAV
FT                   RDPQEMLTHHLLDSLAAVAPLRRHLAQQGGAGRRLLDVGSGGGLPGVVFAICCPDLDVS
FT                   CVDTVAKKAAFIQQAAAALGLRNLHGIHARVETLAGPFDVVSCRAFASLPDFVNWSRQV
FT                   LAPHAVWLAMKGRHPQDEIAALPVGVQVFHVEQLAVPGLDAERCIVWMRPVA"
FT                   /protein_id="YP_004124725.1"
     ATGGTTGATG CCGCGCCGCT GCGCCAGGGC GTGCAGGCCC TCGGCCTGGA CTTGACGGAA        60
     GAACAGATCG CCCGCCTGCT CGACTTCCTG GCCCTGCTGC AGAAGTGGAA CAAGGTCTAC       120
     AACCTCACGG CCGTGCGTGA CCCGCAGGAG ATGCTCACGC ACCACCTGCT CGACAGCCTG       180
     GCTGCCGTGG CGCCCCTGCG GCGCCACCTG GCGCAGCAGG GCGGGGCGGG GCGGCGCCTG       240
     CTGGACGTGG GCAGCGGCGG CGGCCTGCCG GGCGTGGTGT TCGCCATCTG CTGTCCCGAT       300
     CTGGACGTGA GCTGCGTGGA CACCGTGGCC AAGAAGGCTG CATTCATCCA GCAGGCGGCG       360
     GCCGCGCTGG GCCTCAGGAA CCTGCATGGC ATCCACGCGC GCGTGGAAAC GCTGGCCGGC       420
     CCGTTCGACG TGGTGAGCTG CCGAGCCTTC GCCTCGCTGC CGGATTTCGT GAACTGGTCG       480
     CGCCAGGTGC TGGCGCCGCA CGCCGTGTGG CTGGCCATGA AGGGCAGGCA CCCGCAGGAC       540
     GAGATCGCCG CGCTGCCCGT AGGCGTGCAG GTGTTTCACG TGGAACAACT CGCCGTGCCG       600
     GGGCTGGATG CCGAGCGCTG CATCGTCTGG ATGCGGCCCG TGGCTTAA                    648
//

If you have problems or comments...

PBIL Back to PBIL home page