(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE53

ALDEN1_2.PE53        Location/Qualifiers
FT   CDS_pept        63931..64473
FT                   /locus_tag="Alide_0053"
FT                   /gene_family="HOG000140046" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06821"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   ajs:Ajs_0030 hypothetical protein"
FT                   /db_xref="GI:319760791"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="GeneID:10102076"
FT                   /translation="MHPFQVLLLPGWQDSGPGHWQTEWERLHGYRRVQQHDWTRPLRGD
FT                   WSARLEEVVADAPGEVLLAAHSLGCILAAWWAAHTRHARKVHGALLVAPGDVERPDLAA
FT                   QIRGWAPIARRPLPFPAVLAGSRDDPYCAFERARAMAQDWGARFVDLGARGHVNAESGL
FT                   GDWPEGHALLQTLINKD"
FT                   /protein_id="YP_004124728.1"
     ATGCATCCTT TCCAGGTACT CCTTCTGCCC GGCTGGCAGG ACTCCGGCCC TGGCCACTGG        60
     CAAACCGAGT GGGAGCGCCT GCACGGCTAC CGGCGCGTGC AGCAGCACGA CTGGACGCGC       120
     CCGCTGCGTG GCGACTGGAG CGCGCGCCTG GAGGAGGTGG TGGCCGACGC CCCGGGCGAG       180
     GTGCTGCTGG CCGCGCACAG CCTGGGTTGC ATACTCGCCG CGTGGTGGGC TGCGCACACG       240
     CGCCACGCGC GCAAGGTGCA CGGCGCGCTG CTGGTGGCGC CGGGCGACGT GGAACGGCCC       300
     GACCTGGCCG CGCAGATCCG CGGCTGGGCG CCCATCGCGC GCCGGCCGCT GCCCTTTCCC       360
     GCCGTGCTGG CGGGCAGCCG CGACGACCCG TACTGCGCCT TCGAGCGTGC GCGCGCCATG       420
     GCGCAGGACT GGGGCGCGCG CTTCGTCGAC CTGGGCGCGC GCGGGCACGT CAACGCCGAA       480
     TCGGGGCTGG GCGACTGGCC CGAGGGCCAT GCGCTGCTGC AAACACTGAT AAACAAGGAC       540
     TGA                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page