(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE55

ALDEN1_2.PE55        Location/Qualifiers
FT   CDS_pept        65421..66200
FT                   /locus_tag="Alide_0055"
FT                   /gene_family="HOG000224884" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0032"
FT                   /codon_start="1"
FT                   /product="methyltransferase type 12"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0032 methyltransferase type 12"
FT                   /db_xref="GI:319760793"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="GeneID:10102078"
FT                   /translation="MRLSWPLPALLAWGVAWLLHAVLQPRLGTLASLLGATGVGVLASL
FT                   WGQNWWRRALIALGFPLSLALTGAAGLPAWAWLLPLAVLLLVYPLNAWRDAPLFPTPRG
FT                   ALHGLDALAPLPSGAAVLDAGCGLGDGLLALRAAYPRARLHGLEWSWPLALLCRLRCPW
FT                   AHVRRGDIWAAGWGDYQLVYVFQRPESMARAAAKALAEMAPGSWLVSLAFEVPGLAACA
FT                   RLPGFAGQGVWIYRMGASAAAPRGATKECEASADVTL"
FT                   /protein_id="YP_004124730.1"
     ATGCGCCTGT CCTGGCCGCT GCCCGCCTTG CTTGCCTGGG GCGTGGCGTG GCTGCTGCAC        60
     GCCGTGCTGC AGCCGCGCCT GGGCACCCTG GCGTCGTTGC TGGGCGCCAC CGGCGTCGGC       120
     GTGCTGGCCA GCCTGTGGGG GCAGAACTGG TGGCGCAGGG CGTTGATCGC GCTGGGCTTT       180
     CCGCTGTCGC TCGCGCTCAC GGGCGCGGCA GGGTTGCCGG CCTGGGCATG GCTGCTGCCG       240
     CTGGCCGTGC TGCTGCTGGT CTACCCCCTG AATGCATGGC GCGACGCGCC TCTGTTCCCC       300
     ACGCCGCGCG GCGCGCTGCA CGGGCTCGAC GCCCTGGCGC CGCTGCCGTC GGGCGCGGCC       360
     GTGCTCGACG CGGGCTGTGG CCTGGGCGAC GGGTTGCTGG CGCTGCGCGC CGCCTATCCC       420
     CGGGCGCGGC TGCACGGGCT GGAATGGAGT TGGCCACTCG CTCTGCTGTG CCGCCTGCGC       480
     TGCCCCTGGG CGCATGTGCG GCGCGGGGAC ATCTGGGCGG CCGGCTGGGG CGATTACCAG       540
     CTGGTGTACG TGTTCCAGAG GCCCGAAAGC ATGGCGCGCG CGGCGGCCAA GGCGCTGGCC       600
     GAGATGGCGC CGGGAAGCTG GCTGGTCAGC CTGGCGTTCG AGGTGCCGGG CCTGGCTGCC       660
     TGCGCCCGGC TGCCCGGGTT TGCCGGGCAG GGAGTGTGGA TCTACCGTAT GGGCGCCAGC       720
     GCCGCCGCGC CGCGCGGAGC AACAAAAGAA TGCGAGGCAT CTGCAGATGT AACGCTATGA       780
//

If you have problems or comments...

PBIL Back to PBIL home page