(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE56

ALDEN1_2.PE56        Location/Qualifiers
FT   CDS_pept        66260..67300
FT                   /locus_tag="Alide_0056"
FT                   /gene_family="HOG000123847" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /codon_start="1"
FT                   /product="peptidoglycan-binding domain 1 protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   dia:Dtpsy_0052 peptidoglycan-binding domain 1 protein"
FT                   /db_xref="GI:319760794"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="GeneID:10102079"
FT                   /translation="MSRKTLSLLAAACTVVALAGCETTNMKMGSQDAKTVATGAAAGGS
FT                   AANESSQLERCQSPLGTVSLVENQDAGWYTILRNEYKLPPTANLLRLLIQQSNCFVVVE
FT                   RGAAGMRAMDRERQLMGSGEMRGGSNFGKGQMVASDYGLSPEIIFSNNDAGGVGGALGG
FT                   LIGGGRGRALAAIGGSLKTREASAMLTLVDNRSGVQVAASEGSASKSDFAGFGGIFGGS
FT                   AGGGLGGYQNTAQGKVITAAFMDAYNQMVVALRNYKAQSVQGQGLGGGGKLGVDGGAAP
FT                   SQTKAGAAMSVREAQERLNALGYNVGTPDGSAGPKTARALREFQQQQGLPVTGRLDAAT
FT                   AGALSR"
FT                   /protein_id="YP_004124731.1"
     ATGTCCCGCA AAACCCTGTC CCTGCTGGCG GCCGCCTGCA CCGTCGTCGC CCTTGCCGGA        60
     TGCGAAACCA CCAATATGAA GATGGGGAGC CAGGATGCCA AGACCGTGGC CACCGGCGCG       120
     GCTGCGGGAG GCAGCGCCGC CAATGAGAGC AGCCAGCTCG AACGCTGCCA GTCGCCGCTG       180
     GGCACGGTGT CGCTGGTCGA GAACCAGGAC GCCGGCTGGT ACACCATCCT GCGCAACGAA       240
     TACAAGCTGC CGCCCACGGC CAACCTGCTG CGCCTGCTGA TCCAGCAGTC CAACTGTTTC       300
     GTCGTGGTGG AGCGCGGCGC GGCCGGCATG CGCGCCATGG ACCGCGAGCG CCAGCTCATG       360
     GGCTCGGGTG AGATGCGCGG CGGCAGCAAT TTCGGCAAGG GCCAGATGGT GGCCTCCGAC       420
     TATGGCCTGT CGCCCGAAAT CATCTTCAGC AACAACGATG CCGGTGGCGT GGGCGGTGCG       480
     CTGGGCGGCC TGATCGGCGG CGGCAGGGGG CGTGCGCTGG CGGCCATCGG CGGCAGCCTC       540
     AAGACGCGCG AGGCCAGCGC CATGCTGACC CTGGTGGACA ACCGTTCGGG CGTGCAGGTG       600
     GCGGCCTCCG AGGGCAGCGC CTCCAAGAGC GACTTCGCCG GCTTCGGCGG CATCTTCGGC       660
     GGCAGCGCCG GCGGCGGCCT GGGCGGCTAC CAGAACACGG CCCAGGGCAA GGTGATCACG       720
     GCTGCGTTCA TGGACGCCTA CAACCAGATG GTCGTGGCGC TGCGCAACTA CAAGGCGCAG       780
     AGCGTGCAGG GCCAGGGCCT GGGCGGCGGC GGCAAGCTGG GCGTGGACGG TGGTGCCGCA       840
     CCGTCGCAGA CCAAGGCCGG CGCGGCCATG TCCGTGCGCG AGGCGCAAGA GCGCCTAAAC       900
     GCCCTGGGCT ACAACGTGGG TACGCCCGAC GGCTCCGCTG GCCCGAAGAC GGCCCGCGCG       960
     CTGCGCGAGT TCCAGCAGCA GCAGGGCCTG CCCGTGACGG GCCGTCTGGA CGCGGCCACA      1020
     GCCGGCGCGC TGTCGCGCTG A                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page