(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE59

ALDEN1_2.PE59        Location/Qualifiers
FT   CDS_pept        complement(69612..70421)
FT                   /locus_tag="Alide_0059"
FT                   /gene_family="HOG000110051" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /codon_start="1"
FT                   /product="mscs mechanosensitive ion channel"
FT                   /transl_table="11"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   bpy:Bphyt_0752 MscS mechanosensitive ion channel"
FT                   /db_xref="GI:319760797"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="GeneID:10102082"
FT                   /translation="MNTTDIWHFLSTQGTDFAIKLATAIAAWIIGRWLISLAVSLMGKL
FT                   LQRGGKIDTTLAHYLKSITGVLLNIILILAILDIFGVKTTSFAALLAGAGLAIGAAWSG
FT                   MLGNFAAGVFMQVLRPYKVGDFISAGGMVGTVTELGLFATTLTTPDNVMTVVGNGKIFG
FT                   DNIQNFSALPVRRVDCVAKVANSVSPLDAIARLKPVISAIPNVATEPAPDIEILEFTPE
FT                   GPKLCVRPYTHTDHYWQVYFDTNKAIVETFGAAGYPVPETPMAYRNA"
FT                   /protein_id="YP_004124734.1"
     atgaacacca ccgacatctg gcacttcctg agcacacagg gcaccgattt cgcgatcaag        60
     ctggccaccg ccatcgctgc ctggatcatc ggtcgatggc tgatcagcct ggccgtcagc       120
     ctgatgggca agctgctgca acgcggcggc aagatcgaca cgacgctggc gcactacctg       180
     aagtccatca ccggcgtgct gctgaacatc atcctgatcc tggcgatcct ggacatcttc       240
     ggcgtcaaga cgacttcgtt cgccgcgctg ctggcgggcg ccggcctggc catcggcgcg       300
     gcctggagcg gcatgctggg caactttgcc gcgggcgtct tcatgcaggt gctgcggccc       360
     tacaaggtgg gcgacttcat cagcgccggc ggcatggtgg gcacggtgac ggagctaggc       420
     ctgttcgcca caacgctgac cacgcccgac aacgtgatga ccgtggtggg caacggcaag       480
     atcttcggag acaacatcca gaacttcagt gccctgccgg tgcgccgcgt ggactgcgtg       540
     gccaaagtgg ccaacagcgt gagcccgctg gacgccatag cgcgcctcaa gccggtgatc       600
     tccgccatcc ccaacgtggc gaccgagccg gcgccggaca tcgagatcct ggaattcacc       660
     cccgaaggcc ccaagctgtg cgtgcgcccc tacacccaca ccgaccacta ctggcaggtg       720
     tacttcgaca cgaacaaggc catcgtcgag accttcggcg ccgccggcta tcccgtgccc       780
     gagacgccga tggcctaccg gaacgcctga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page