(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE6

ALDEN1_2.PE6         Location/Qualifiers
FT   CDS_pept        complement(7277..8134)
FT                   /locus_tag="Alide_0006"
FT                   /gene_family="HOG000027939" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /codon_start="1"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /transl_table="11"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   reh:H16_A2138 enoyl-CoA hydratase/carnithine racemase"
FT                   /db_xref="GI:319760744"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="GeneID:10102029"
FT                   /translation="MQAEDSEAWVLASRVGPVARIHLNRGDARNPLGVEMVQALSAAVG
FT                   EASGQSGVRVILLTAAGPAFSAGGNLGNLGDRLAATAGPDGRDPIAAGNRRYGEFLTQL
FT                   VNVPQVTVACVQGAAMGGGAGLACAVDIAIGSPEVKFGFPEAAIGLVPGQILPFVAARL
FT                   GLPAARRLVLTGRRIAAAEAHRIGLLDYVAESHQALGALTRQVLESVVATAPQASACTK
FT                   RMLGRLPVAPLQASGALQGYLDEAAELFARQMRSEAMEGVSAAREKRPARWNEAGELSA
FT                   LDLA"
FT                   /protein_id="YP_004124681.1"
     atgcaagcag aagacagcga agcctgggtg ctcgcgtccc gcgtggggcc ggtggcccgc        60
     atccatctga accgcggcga tgcccgcaac cccctggggg tggagatggt gcaggcattg       120
     tccgcggcgg tgggcgaggc atccggccag agcggggtgc gcgtcatcct gctgacggcc       180
     gcgggcccgg cgttcagcgc cgggggcaac ctgggcaacc tgggtgacag gctggccgcc       240
     acggcggggc ccgacgggcg cgaccccatc gccgcaggca accgccgcta cggcgagttc       300
     ctgacgcagc tggtgaacgt gccacaggtg accgtggcct gcgtccaggg cgcggccatg       360
     ggcggcggcg cgggcctggc ctgcgcggtg gacatcgcca tcggctcgcc cgaggtgaag       420
     ttcggctttc ccgaggccgc gatcggcctg gtgccggggc agatcctgcc cttcgtcgcc       480
     gcgcgcctgg gcctgcccgc ggcccggcgg ctggtgctga ccgggcggcg catcgccgct       540
     gccgaggccc accgcatcgg cctgctggac tacgtggccg aatcgcacca ggcgctgggc       600
     gcgctcacgc ggcaggtgct ggaatccgtc gtggccacgg cgccgcaagc ctcggcctgc       660
     accaagcgca tgctgggccg gctgcccgtg gcgccgctgc aggccagcgg cgcgctgcag       720
     ggctacctgg acgaggccgc ggagctgttc gcccgccaga tgcgctcgga ggcgatggag       780
     ggcgtgagcg ccgcccgcga aaagcggccc gcccgctgga atgaggccgg cgagctgtcg       840
     gcactggatc ttgcatag                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page