(data stored in ACNUC7421 zone)


ALDEN1_2.PE60        Location/Qualifiers
FT   CDS_pept        70500..70595
FT                   /locus_tag="Alide_0060"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:319760798"
FT                   /db_xref="GeneID:10102083"
FT                   /translation="MAVPMSGPAATRHTVLQEKASNALCMGAISY"
FT                   /protein_id="YP_004124735.1"
     TCCAACGCCC TGTGCATGGG CGCTATAAGC TACTGA                                  96

If you have problems or comments...

PBIL Back to PBIL home page