(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE63

ALDEN1_2.PE63        Location/Qualifiers
FT   CDS_pept        complement(73036..73581)
FT                   /locus_tag="Alide_0063"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Rsph17025_2099"
FT                   /codon_start="1"
FT                   /product="phage virion morphogenesis protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rsq:Rsph17025_2099 phage virion morphogenesis
FT                   protein"
FT                   /db_xref="GI:319760801"
FT                   /db_xref="GeneID:10102086"
FT                   /translation="MPQIIELPDRSGLDYLHALVERGQNLQPLLKEIGEDQAEETKQRF
FT                   ATATDPDGNAWAPNSALTLANYSALFARKKDGSLTKRSAEKLAGKKPGTGETRMLGTTI
FT                   NYQVHGDDAVGVGSPMVYAGTFHYGAKSGEFGFGMYATRNGSFPIPWGDIPARRFLGMS
FT                   QTGRENVVSLVRSYFLEG"
FT                   /protein_id="YP_004124738.1"
     atgccgcaaa tcatcgagct gcccgaccgc agcggcctgg actacctgca tgccctggtc        60
     gagcgtggcc agaacctgca gccgctgctg aaggagatcg gcgaggacca ggccgaggag       120
     acgaagcaac gctttgccac ggccaccgac ccggacggca acgcatgggc gcccaacagc       180
     gccctgacgc tggcgaacta cagcgctctg ttcgcccgca agaaggacgg ctcgctaacc       240
     aagcgcagcg cggagaagct cgcaggcaag aagcccggca cgggcgagac gcgcatgctg       300
     ggcaccacga tcaactacca ggtgcacggg gacgatgccg tgggtgtcgg tagcccgatg       360
     gtctacgccg gcaccttcca ctacggcgca aagtccggcg agttcggctt cgggatgtac       420
     gccacgcgca atggcagctt tccgatcccg tggggggaca tcccggcgcg gcggttcctg       480
     ggtatgtccc agacaggccg ggagaacgtc gtcagcttgg tgcgttcgta cttcctggag       540
     ggctga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page