(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE65

ALDEN1_2.PE65        Location/Qualifiers
FT   CDS_pept        complement(74883..76379)
FT                   /locus_tag="Alide_0065"
FT                   /gene_family="HOG000070347" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06074"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF935; KEGG:
FT                   rsc:RCFBP_11714 hypothetical protein"
FT                   /db_xref="GI:319760803"
FT                   /db_xref="InterPro:IPR009279"
FT                   /db_xref="GeneID:10102088"
FT                   /translation="MKQGIYVTPTEFVSFGEAKRRTSTLGEEVATRARSMDVAGFSFLL
FT                   PNPDPILKRQGKDMRVYRDLRSDAHVGGCIRRRKASVKKLERRVVAGKAGARAVRRAED
FT                   LFSALNMDRVMNEVLDGVLYGWQPLELMWGYRAGALQPLDVVGKPGEWFTFDNEAQLRF
FT                   RSREHPLHGEALEPRKFLLARQEASYANPYGFADLSMCFWPTVFKRGGLKFWVTFTEKY
FT                   GTPWLVGKQPRGTPGPEVEELLDKLEAMIQDAVAAIPDDSSIDVLEAGDKGASAELYKE
FT                   LLMFCRSEVSIALLGQNQSTEASSTHASAVAGLEVAEAIRDGDARMVEATFNQMLRWVT
FT                   DLNEGENAPAPTVELYEEESVNTKLAERDSNLKSAGVNFTTQYWMRAYKLEKGDIAEQA
FT                   APVAVPGAPGVEFAEGTGPTVPAETLAALTAGASPVVELWLREMRRLVEAHRDPQRLQA
FT                   DLLEAFGDLPTGELAALMAAAFELAELQGRDRAAQEAGHG"
FT                   /protein_id="YP_004124740.1"
     atgaagcaag gtatctacgt cacccccacc gagttcgttt cgttcggtga agccaagcgc        60
     cgcacgtcca cgctgggcga ggaggtcgcc acccgcgccc gctctatgga cgtggcgggc       120
     ttttccttcc tgctgcccaa tccggacccg atcctcaagc gccagggtaa ggacatgcgg       180
     gtgtaccgtg acctgcgcag cgatgcgcac gtgggcggct gcatccgcag gcgcaaggct       240
     tcggtgaaga agctggagcg ccgcgtggtg gccggcaaag ccggcgcgcg tgccgtgcgg       300
     cgtgccgaag acctgttctc ggccctgaac atggaccgcg tgatgaacga ggtgctcgat       360
     ggcgtgctgt acggctggca accgctcgag ctgatgtggg gctaccgcgc gggcgcgctg       420
     cagccgctgg acgtggtggg caagccgggc gagtggttca ccttcgacaa cgaggcgcaa       480
     ctgcgctttc gttcgcgtga gcatccattg cacggcgagg cgctggagcc gcgcaagttc       540
     ctgctggcca ggcaggaggc gagctacgcg aacccctacg gtttcgcgga tctgtcgatg       600
     tgcttttggc ccaccgtttt caagcgcggc gggctcaagt tctgggtgac cttcaccgag       660
     aaatacggca cgccgtggct ggtgggcaag cagccgcgcg gcacgccggg cccggaagtc       720
     gaggagctgc tggacaagct ggaagcgatg atccaggacg cggtggcggc catcccggac       780
     gattccagca tcgacgttct ggaggcaggg gacaaggggg cgagcgcaga gctctacaag       840
     gagctgttga tgttctgccg tagcgaagtg tcgatcgcgc tgctgggcca gaaccagagc       900
     accgaggcga gcagcacgca cgccagcgcg gtcgctggcc tggaagtggc ggaggccatc       960
     cgcgacggcg acgctcgcat ggtcgaggcc actttcaatc agatgctgcg ctgggtgacc      1020
     gatctgaatg agggcgagaa cgccccggcg cctacggtgg agctgtatga ggaggaaagc      1080
     gtcaacacca agctggccga acgcgattcc aatctcaaga gcgcgggcgt gaacttcacg      1140
     acccagtact ggatgcgcgc ctacaagctg gagaaggggg acatcgcgga gcaggccgcg      1200
     cctgtggccg tgcctggtgc gccaggcgtg gagttcgccg agggaaccgg ccctaccgtg      1260
     cctgcagaga cgctggccgc tttgacggcc ggggcgtcgc ccgtggtgga gctctggctt      1320
     cgggagatgc gccgcctggt ggaggcgcac cgcgatccgc agcggctgca ggcagacctg      1380
     ctggaggcat tcggagattt gcccacaggg gagctggccg cgctgatggc agcagcgttt      1440
     gaattggccg agctgcaggg ccgcgatcgg gcggcacagg aggctggcca tggctga         1497
//

If you have problems or comments...

PBIL Back to PBIL home page