(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE66

ALDEN1_2.PE66        Location/Qualifiers
FT   CDS_pept        complement(76376..77050)
FT                   /locus_tag="Alide_0066"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:RC1_1112"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rce:RC1_1112 terminase large subunit"
FT                   /db_xref="GI:319760804"
FT                   /db_xref="GeneID:10102089"
FT                   /translation="MSRATDYTNAAQQRILHLQLALFGDVVHGYPPSKLAELLRVPASA
FT                   ITRDLDNLRTIAPNEIETNLHQRIPFIAEMKNVPYNQQLQVLFAIGDALPRKCGMVIDS
FT                   RGNGSYVGEAAHDKYGSVVQRLMPTEGWYRDNMPPYKAALEDGTILVPKHDGLLQGHRA
FT                   IRLIRGVPRMPESTDKEIGHGDSTMACIYSHAAARMDWGPTHAASRPRRSRLDVSMEGY
FT                   YE"
FT                   /protein_id="YP_004124741.1"
     atgagccgcg ccaccgacta caccaacgcc gcgcagcagc gcatcttgca cctgcagctg        60
     gccctgttcg gcgacgtggt ccatgggtac ccgcccagca agcttgccga gctgctgcgc       120
     gtgccagcta gcgccatcac ccgcgacctg gacaacctgc ggactatcgc tccgaacgag       180
     atcgagacga acctgcacca gcgcatcccc ttcatcgccg agatgaagaa cgtgccctac       240
     aaccagcagc tgcaggtgct gtttgcgatc ggcgatgcac tgccgcgcaa gtgtggcatg       300
     gtgatcgaca gccgaggcaa cggcagctat gtgggcgagg cggcgcacga caagtacgga       360
     tcggtggtgc agcggctaat gcctaccgag ggctggtacc gcgacaacat gccgccctac       420
     aaagcggcgc tggaggacgg aaccatcctg gtgcccaagc acgatggcct gctgcagggc       480
     caccgcgcca ttcgcctgat ccgcggcgtg ccccgcatgc ccgaatctac cgacaaggaa       540
     atcggccacg gtgacagcac gatggcctgc atctattcgc acgccgccgc acgcatggac       600
     tgggggccga cacatgccgc cagccgcccg cgccgcagcc gcctggatgt gtccatggag       660
     ggctactacg aatga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page