(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE68

ALDEN1_2.PE68        Location/Qualifiers
FT   CDS_pept        complement(77251..77721)
FT                   /locus_tag="Alide_0068"
FT                   /gene_family="HOG000222052" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CV_2153"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cvi:CV_2153 hypothetical protein"
FT                   /db_xref="GI:319760806"
FT                   /db_xref="GeneID:10102091"
FT                   /translation="MIRRDWKRLRASSLVHAMRLCKEYAQAKHNLSVERIADRMGATHD
FT                   TLYKWLATGRMPAILIPAYELACGCHYISDWLAASAGRLVVPMPTGRKAEGTELLDMNS
FT                   SCAAALQLLTAFYQAPTEADTEATLAALRLHLEQVAYHHHNVAQYATPELEF"
FT                   /protein_id="YP_004124743.1"
     atgatccgca gagattggaa acgcctgcgc gccagcagcc tggtgcacgc catgcgcctg        60
     tgcaaggagt acgcccaggc caagcacaac ctgagcgtgg agcgcatcgc agaccgcatg       120
     ggtgccaccc acgacacgct ctacaagtgg ctggccacgg ggcgcatgcc cgccatcctg       180
     atcccagcct acgagctggc ctgcggctgc cactacatca gcgactggct ggccgccagc       240
     gccggccgcc tggtggtgcc catgcccacc ggccgcaaag ccgagggcac agaactactg       300
     gacatgaaca gcagctgcgc cgccgccctg caactgctca ccgccttcta ccaagcaccc       360
     acggaggccg acaccgaagc caccctggcc gccctgcgtc tgcacctaga gcaggtggcc       420
     taccaccacc acaacgtggc gcagtacgcc acccctgaac tggagttttg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page